KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0916600-01
Entry
Os01t0916600-01   CDS       T02163                                 

Gene name
Os01g0916600, GLYCINE-RICH_RNA-BINDING_PROTEIN_1, GRP1
Definition
(RAP-DB) RNA recognition motif, glycine rich protein domain containing protein.
  KO
K13195  cold-inducible RNA-binding protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dosa03041]
    Os01t0916600-01 (Os01g0916600)
Spliceosome [BR:dosa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    Os01t0916600-01 (Os01g0916600)
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_5 RRM_3 GRP
Other DBs
RAP-DB: Os01t0916600-01
Oryzabase: 8937
Position
chr01:join(39955222..39955348,39955435..39955503,39955600..39955706,39955998..39956147)
AA seq 150 aa
MAAFNKLGSFLRHSGLTSSASAGSSPAMFNAARLMSTKLFVGGLSWNTNDDSLKEAFTSF
GDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDAMDGKELEGRSIRVNFANERPPGN
RGGGGYGGGGGGYGNQGGYGDGNRGYGGQY
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcggccttcaacaagctcggtagcttcctcaggcacagtggcttgacaagcagtgcc
tcggccggctcttcccctgccatgttcaatgctgctcgtctgatgtccaccaagcttttc
gttggtggtctttcttggaatactaatgacgattcgctgaaagaggcattcaccagcttc
ggggatgtgactgaagctcgggtgatcaatgacagagaatctggaaggtcaagagggttt
ggctttgttagctttgccaatggcgatgatgccaagagtgccatggatgccatggacggt
aaggaacttgagggacggagtatccgcgtgaacttcgcgaatgagagacctccagggaac
cgaggtggcggcgggtatggtggtggtggcggtggttatggtaaccaaggaggctatggt
gatggcaaccgaggctatggagggcagtactaa

DBGET integrated database retrieval system