KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0106100-01
Entry
Os02t0106100-01   CDS       T02163                                 

Gene name
Os02g0106100
Definition
(RAP-DB) Similar to Fructosyltransferase.
  KO
K21351  sucrose:sucrose fructosyltransferase [EC:2.4.1.99]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Os02t0106100-01 (Os02g0106100)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.99  sucrose:sucrose fructosyltransferase
     Os02t0106100-01 (Os02g0106100)
SSDB
Motif
Pfam: Glyco_hydro_32N DUF3357 Glyco_hydro_32C
Other DBs
RAP-DB: Os02t0106100-01
Position
chr02:join(343154..343580,343956..344827,345830..346519)
AA seq 662 aa
METRDDVADASALPYSYSPLPAGDAASADLAAARRSRRRPLCVALFLASAAVILAVAVLS
GVRLAGRPATTTMVVPGVVEMEMASRGPESGVSEKTSGAEEMVRLMGGAAGGEAFPWSNA
MLQWQRTGFHFQPERNWMNDPNGPVYYKGWYHLFYQYNPDGAVWGNKIAWGHAVSRDLVH
WRHLPLAMVPDQWYDVNGVWTGSATTLPDGRLAMLYTGSTNASVQVQCLAVPSDPDDPLL
TNWTKYHANPVLYPPRTIGDRDFRDPTTAWRDPSDGDWRIVIGSKDEHHAGIAVVYRTAD
FVTYDLLPGLLHRVEATGMWECIDFYPVAGGEGVDMTEAMYARNKGVVHVMKASMDDDRH
DYYALGRYDPARNAWTPLDAAADVGIGLRYDWGKFYASKTFYDPAKRRRVLWGWVGETDS
ERADVAKGWASLQSIPRTVELDTKTGSNLLQWPVEEVETLRTNSTDFGGITVDYASVFPL
NLHRATQLDILAEFQLDPLAVDAVLEADVGYNCSTSGGAAGRGALGPFGLLVLADKRHRG
DGEQTAVYFYVAKGSDGGVTTHFCQDESRSSHADDIVKRVVGNVVPVLDGETFSLRVLVD
HSIVESFAQGGRSTATSRVYPTEAIYANAGVFLFNNATSARVTAKKLVVHEMDSSYNQAY
MA
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggagacccgggacgacgtcgccgacgcctcggcgcttccctactcctactcgccgctc
cccgccggggacgccgcctccgccgacctcgccgccgcccgccgttcccggaggcgcccg
ctctgcgtcgccctgttcctcgcctccgccgcggtgatcctcgccgtggcggtcctctcc
ggcgtcaggctcgccgggcgccccgcgacgacgacgatggtcgtcccgggggtggtggag
atggagatggcgagcagggggccggagtccggcgtgtcggagaagacgtcgggggcggag
gagatggtgaggctgatgggcggcgcggcgggtggggaggcgttcccgtggagcaacgcg
atgctgcaatggcagcgcaccggattccatttccagcccgagaggaactggatgaacgat
cccaacggtccggtgtactacaagggttggtaccacctgttctaccagtacaacccggat
ggggcggtgtggggcaacaagatcgcgtgggggcacgcggtgtcccgcgacctcgtccac
tggcgccacctccccctcgccatggttcccgaccagtggtacgacgtcaacggcgtctgg
accggctccgccaccaccctccccgacggccgcctcgccatgctctacaccggctccacc
aacgcctccgtccaggtccagtgcctcgccgtcccctccgaccccgacgaccccctcctc
accaactggaccaagtaccacgccaaccccgtcctctaccctccccgcaccatcggcgac
cgcgacttccgcgaccccaccaccgcctggcgcgacccctccgacggcgactggcggatc
gtcatcggctccaaggacgagcaccacgccggcatcgccgtcgtctaccgcaccgccgac
ttcgtcacctacgacctcctcccgggcctcctccaccgcgtcgaggccacggggatgtgg
gagtgcatcgacttctacccggtggccggcggcgagggggtggacatgacggaggcgatg
tacgcgaggaacaagggggtggtgcacgtgatgaaggcgagcatggacgacgatcgccat
gactactacgcgctggggaggtacgacccggcgaggaacgcgtggacgccgctggacgcc
gccgccgacgtcggcatcggcctccgctacgactggggcaagttctatgcctccaagacc
ttctacgatccggccaagcgccgccgcgtcctctggggttgggtcggcgagaccgactcc
gagcgcgccgacgtcgccaagggttgggcttccctccagtcgattcctcggacggtggag
ctggacaccaagacggggagcaacctgctgcaatggccggtggaggaggtggagacgctg
cgcaccaactccaccgacttcggcggcatcaccgtcgactacgcctccgtcttcccgctc
aacctccaccgcgccacgcagctcgacatcctcgccgagttccagctcgacccgctcgcc
gtcgacgccgtcctcgaggccgacgtcggctacaactgcagcaccagcggcggcgcggcc
ggccggggcgccctgggccccttcgggctgctggtgctcgccgacaagcgccaccgcggg
gatggggagcagaccgccgtgtacttctacgtggccaaggggagcgacggcggcgtcacg
acgcacttctgccaggacgagtcgaggtcgtcgcacgccgacgacatcgtcaagagggtc
gtcggcaacgtcgtcccggtgctcgacggcgagaccttctccctccgggtgctcgtcgac
cactccatcgtcgagagcttcgcgcagggggggaggtccacggcgacgtcgcgggtgtac
cccacggaggccatctacgccaacgccggcgtcttcctcttcaacaacgccaccagcgcg
cgcgtcacggccaagaagctcgtcgtccacgagatggactcctcctacaaccaagcctac
atggcctag

DBGET integrated database retrieval system