KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0120800-01
Entry
Os02t0120800-01   CDS       T02163                                 

Gene name
Os02g0120800, RAC/ROP-TYPE_GTPASE_6, RAC6
Definition
(RAP-DB) Similar to Small GTP-binding protein (Fragment).
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04145  Phagosome
dosa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Os02t0120800-01 (Os02g0120800)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Os02t0120800-01 (Os02g0120800)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os02t0120800-01 (Os02g0120800)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dosa04147]
    Os02t0120800-01 (Os02g0120800)
   04031 GTP-binding proteins [BR:dosa04031]
    Os02t0120800-01 (Os02g0120800)
Membrane trafficking [BR:dosa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    Os02t0120800-01 (Os02g0120800)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    Os02t0120800-01 (Os02g0120800)
  Macropinocytosis
   Ras GTPases
    Os02t0120800-01 (Os02g0120800)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    Os02t0120800-01 (Os02g0120800)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Os02t0120800-01 (Os02g0120800)
  Exosomal proteins of other body fluids (saliva and urine)
   Os02t0120800-01 (Os02g0120800)
  Exosomal proteins of colorectal cancer cells
   Os02t0120800-01 (Os02g0120800)
  Exosomal proteins of bladder cancer cells
   Os02t0120800-01 (Os02g0120800)
GTP-binding proteins [BR:dosa04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    Os02t0120800-01 (Os02g0120800)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
RAP-DB: Os02t0120800-01
Oryzabase: 6293
Position
chr02:complement(join(1083757..1083855,1082591..1082678,1082398..1082507,1081938..1082001,1081306..1081370,1081111..1081176,1080923..1081024))
AA seq 197 aa
MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD
TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL
DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVLQP
PKAKKKKKAQRGACSIL
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagcgcgtccaggttcataaagtgcgtcaccgtcggggacggcgccgtcggcaagacc
tgcatgctcatctcctacacctccaacaccttccccactgattatgttccgacggtgttt
gacaacttcagtgccaacgtcgtggttgatggtaacaccgtcaacctcgggctatgggac
actgcaggtcaggaggattacaacagactgagaccactgagttatcgtggagctgatgtt
ttccttctggccttctcgctaatcagcaaggccagctatgagaatgtttcaaagaagtgg
atacctgagctgaagcattatgcacctggtgtgcctatcatccttgtgggaacaaagctt
gatcttcgagatgacaagcagttttttgtggaccatcctggtgctgttcctatcaccact
gctcagggagaggaactaagaaagcaaataggcgccccatactacatcgaatgcagctca
aagacccaactaaacgtcaagggcgttttcgatgcggcaataaaggtggtgctgcagcca
cccaaggcgaagaagaagaaaaaggcgcaaaggggggcgtgctccattttgtga

DBGET integrated database retrieval system