KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0170500-01
Entry
Os02t0170500-01   CDS       T02163                                 

Gene name
Os02g0170500, HAP5_SUBUNIT_OF_CCAAT-BOX_BINDING_COMPLEX, HAP5A
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os02t0170500-01 (Os02g0170500)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os02t0170500-01 (Os02g0170500)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF
Other DBs
RAP-DB: Os02t0170500-01
Oryzabase: 8491
Position
chr02:complement(3846492..3847271)
AA seq 259 aa
MEPSSQPQPVMGVATGGSQAYPPPAAAYPPQAMVPGAPAVVPPGSQPSAPFPTNPAQLSA
QHQLVYQQAQQFHQQLQQQQQQQLREFWANQMEEIEQTTDFKNHSLPLARIKKIMKADED
VRMISAEAPVVFAKACEVFILELTLRSWMHTEENKRRTLQKNDIAAAITRTDIYDFLVDI
VPRDEMKEEGLGLPRVGLPPNVGGAADTYPYYYVPAQQGPGSGMMYGGQQGHPVTYVWQQ
PQEQQEEAPEEQHSLPESS
NT seq 780 nt   +upstreamnt  +downstreamnt
atggaaccatcctcacagcctcagcctgtgatgggtgttgccactggtgggtcacaagca
tatcctcctcctgctgctgcatatccacctcaagccatggttcctggagctcctgctgtt
gttcctcctggctcacagccatcagcaccattccccactaatccagctcaactcagtgct
cagcaccagctagtctaccaacaagcccagcaatttcatcagcagctgcagcaacagcaa
cagcagcaactccgtgagttctgggctaaccaaatggaagagattgagcaaacaaccgac
ttcaagaaccacagcttgccactcgcaaggataaagaagataatgaaggctgatgaggat
gtccggatgatctcggcagaagcccccgttgtcttcgcaaaggcatgcgaggtattcata
ttagagttaacattgaggtcgtggatgcacacggaggagaacaagcgccggaccttgcag
aagaatgacattgcagctgccatcaccaggactgatatctatgacttcttggtggacata
gttcccagggatgaaatgaaagaagaagggcttgggcttccgagggttggcctaccgcct
aatgtggggggcgcagcagacacatatccatattactacgtgccagcgcagcaggggcct
ggatcaggaatgatgtacggtggacagcaaggtcacccggtgacgtatgtgtggcagcag
cctcaagagcaacaggaagaggcccctgaagagcagcactctctgccagaaagtagctaa

DBGET integrated database retrieval system