KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0290300-01
Entry
Os02t0290300-01   CDS       T02163                                 

Gene name
Os02g0290300
Definition
(RAP-DB) WD40/YVTN repeat-like domain containing protein.
  KO
K17985  activating molecule in BECN1-regulated autophagy protein 1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os02t0290300-01 (Os02g0290300)
   03029 Mitochondrial biogenesis [BR:dosa03029]
    Os02t0290300-01 (Os02g0290300)
Membrane trafficking [BR:dosa04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    Os02t0290300-01 (Os02g0290300)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    Os02t0290300-01 (Os02g0290300)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 PD40
Other DBs
RAP-DB: Os02t0290300-01
Position
chr02:complement(join(10983487..10983578,10982517..10982666,10982169..10982285,10982012..10982096,10981244..10981352,10981083..10981150,10980851..10980976,10979934..10980624,10979511..10979826,10978851..10979054,10978687..10978747,10978298..10978411,10977773..10977886,10977606..10977692,10975043..10975069))
AA seq 786 aa
MAEHWAEGSKHASAQASYSRYQATSARSRQRNIFDLLAQREISPRTKHQAKKLWSKSPGN
DADSNELRYAATDAKHDIYSWAESQSLHHWSAKYCPLLPPPRSTIAAAFSPDGKTLASTH
GDHTVKIIDYQTGKCLKVLSGHRRTPWVVRYHPLLPDILASGSLDQEVRLWDAKTSDCIG
SQDFHRPIASIAFHARGEILAVASGHKLYIWNYNKRDEAAAPTIILRTRRSLRAVHFHPH
GAPYLLTAEVNNLDSADSPLTLATSSGYSNYPSAVFFANINSRNCPHHEANSSSPCLLWP
AYLRDDGSLCLIRNDLVSSSTNVHQRPSSLAQNPLASDVENQQPDQLVTPMDVCPGEPST
SHASASGLSGVEMQIDRGQPSSRLLGSSSTSNHESSTARDDVQMPSLSNSVPIPATSQPS
EHDGRHGMPMNSFTTSSGLDVHMILRNSEGGNHHHDLFSDSRSWELPFLQGWFMAQNHTG
ASPSIPIDVGSSRGSNRHHASRRHVVGSLRGVGSSLLGPQIDEAEVHAASLGVGSELTTS
LLAAGAAELPCTVKLRIWRHDIKDPCVTLEPEACRLTISHAVLCSEMGAHFSPCGRFLVA
CVACLLPQTEGDRGSQLPVQYDSAGAGTSPTRHPLPSHRVIYELRVYSLEEATFGKVLTS
RAIRAAHCLTSIQFSPTSEHILLAYGRRHNSMLRSIVMDGETGIPVYTILEVYRVSDMEL
VRVLPSAEDEVNVACFHPSPGGGLVYGTKEGKLRILQHNGADITSTGLNCFIEENMLEIQ
RYALEG
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggctgaacattgggcagaaggttcaaagcatgcttctgcacaagcatcgtattctaga
tatcaagcaacatctgcaagatctaggcaaaggaacatcttcgatctattagctcagcga
gagatttcccctcgaacaaaacaccaagctaaaaaactttggagcaaatctccaggaaat
gatgctgattccaatgaactaagatatgcagctacagatgctaaacatgatatatattca
tgggcagaatcacagtccctgcatcactggtctgccaaatattgtcctcttttgccaccc
cccaggtctactatcgcagctgcattcagcccagatgggaaaacacttgcatctacacat
ggtgatcatactgttaaaataattgactatcaaactgggaaatgtttgaaagtgctgagt
ggacatcggcgcacgccttgggtggttagataccatccattacttcctgatatccttgct
agcggtagtttggatcaggaagtccgtctttgggacgctaaaacctcagactgtattgga
tctcaggacttccatcggccaattgcatcaatagcatttcatgcaaggggggagattctg
gcagttgcatcaggtcacaaactgtacatatggaactacaataaaagagatgaggctgct
gctccaaccattatattaagaacccgccgctcactaagagctgtccattttcacccccat
ggtgctccatatcttcttactgcagaggttaataatcttgattctgcggactcaccattg
acccttgcaacctcttcgggctattcaaactatccctcggctgtgttttttgcaaatatt
aattccagaaactgtccacatcatgaggctaattcatcatcaccttgcttgctttggcct
gcatacctcagggatgatggaagtttatgtctgattcgcaatgacttggttagtagttca
accaatgtgcatcagagaccatcatctttagctcaaaatccattggcatcagatgttgaa
aatcaacagcctgaccaacttgtcacgcctatggatgtgtgccctggagaaccatctact
tctcatgcttctgcatctggtttaagtggagttgaaatgcagattgacagggggcaacct
agctccagattactgggcagtagctccactagtaatcatgagagttctactgctagagat
gatgtgcaaatgccctccctgagcaacagcgtgccgattccagcaacatctcagccttca
gaacatgatggccgtcatggtatgccaatgaattcgtttaccacttctagtggattagat
gttcacatgatcctaagaaattcagagggtggaaatcatcatcatgatctcttcagtgac
tcgcgtagctgggagcttccctttttgcagggctggttcatggcccaaaatcatacaggt
gcttctccatctattccgattgatgtcggcagttctagaggatcaaatcgacatcatgct
tctcgtcgtcatgttgtgggctcattacgtggggttgggagttcacttctaggcccccaa
attgatgaagctgaggttcatgctgcatcattaggtgttggatctgaacttactacctca
ctgcttgctgctggagctgctgaattaccttgcacagtgaagcttagaatatggcggcat
gatatcaaggatccatgtgttacattggaacccgaggcatgccggttgacaatttctcat
gccgttctctgcagtgaaatgggtgcccatttttccccttgtggacgatttctggtagca
tgtgttgcctgtttgctgcctcaaactgaaggcgaccgtggtagccaattgcctgtgcag
tatgattctgcaggggccggaacatcaccaactcgtcaccctctcccttctcaccgagtt
atttatgagctccgagtttactctcttgaggaggcaacgtttggcaaagttcttacatca
agagcgataagggcagctcattgcttaacttccatccagttctcacccacttcagagcac
atactattggcatatggtcgtcgtcataactctatgcttaggagcattgtgatggatggg
gaaactggaattcctgtatatactatcttggaggtctatagagtatcggacatggagctg
gtaagagttcttcctagtgctgaagatgaagtaaacgttgcatgctttcatccttcccct
ggaggtggtcttgtttatgggaccaaggaaggaaagctcaggatcttgcagcacaatggt
gcagatatcacaagcacagggttgaattgctttatcgaggaaaatatgcttgagattcag
agatatgcgctggaaggctga

DBGET integrated database retrieval system