KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0301500-01Help
Entry
Os02t0301500-01   CDS       T02163                                 

Gene name
Os02g0301500
Definition
(RAP-DB) Similar to ATP dependent RNA helicase.
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Os02t0301500-01 (Os02g0301500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dosa03041]
    Os02t0301500-01 (Os02g0301500)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Os02t0301500-01 (Os02g0301500)
Spliceosome [BR:dosa03041]
 Complex C
  Other components
   Step II factors
    Os02t0301500-01 (Os02g0301500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD
Motif
Other DBs
RAP-DB: Os02t0301500-01
Position
chr02:join(11670441..11671687,11672930..11673323)
AA seq 546 aa AA seqDB search
DENLSQYSVIMLDEAHERTIHTDVLFGLLKQLIKRRSDMRLIVTSATLDAEKFSGYFFNC
NIFTIPGRTFPVEILYTKQPESDYLDAALITVLQIHLTEPEGDILLFLTGQEEIDHACQC
LYERMKGLGKDVPELIILPVYSALPSEMQSKIFDPAPPGKRKVVVATNIAEASLTIDGIY
YVVDPGFAKINVYNSKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEM
SPTTIPEIQRINLGSTVLNMKAMGINDLLSFDFMDPPAPQALISAMEQLYSLGALDEEGL
LTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKR
AKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLTIMDRYKLD
VVSAGRNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYH
ELVMTTKEYMREVTVIDPKWLTELAPRFYKSADPTKMSKRKRQERIEPLYDRYHEPNSWR
LSKRRA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
gatgagaacctttcccagtattctgtaattatgcttgatgaagcgcatgaaaggaccata
cacacagatgttctctttggcttgctgaaacagcttattaagcgcagatctgacatgagg
cttattgttacttctgctaccctggacgcagagaagttctcagggtattttttcaattgc
aacatcttcacaattcctggaaggacgttcccggtagagatactctacaccaaacaacca
gaaagtgactatttggatgcagcattgatcaccgtgcttcaaatacacttgactgagcca
gaaggtgatatcctcctttttttgactggtcaagaggagattgatcatgcttgtcaatgt
ctttatgagaggatgaaagggctagggaaggatgttcctgagctcataatattgcctgtt
tatagtgctcttccgagtgaaatgcagtcgaagatctttgacccagctcctccagggaag
aggaaggttgttgtggccaccaatatcgctgaagcttctctaaccattgacggcatatat
tatgtcgtcgatcctggttttgccaaaattaatgtttataattcaaaacaaggactcgat
tcattggtcatcactccaatctctcaagcatcagcgaagcagagggcagggcgtgctggg
cgtactggccctggcaaatgctatcgtctatacactgaaagtgcataccgcaatgaaatg
tctcccacaacaatcccagaaattcaaaggattaacttggggtctacagttctcaacatg
aaggcgatgggaatcaatgacctattatcctttgatttcatggaccctcctgcacctcaa
gcacttatatctgcaatggagcaattgtacagcctaggtgctcttgatgaagaagggctc
cttaccaaactggggaggaaaatggctgaatttccactggatccaccactttcgaagatg
cttctagccagcgttgaccttggatgcagtgatgagatactaactattatagctatgata
caaactgggaacattttctataggccaagagaaaaacaggctcaggctgatcaaaagagg
gccaagtttttccagccagagggggatcatctaactctgcttgctgtatatgaggcgtgg
aaggcaaaaaacttttcagggccctggtgttttgagaactttgttcaatcaagatcctta
aggagagctcaagatgtgaggaagcagcttctcactatcatggacagatataaattggat
gttgtctcagctgggaggaacttcacaaaaataaggaaagcaatcactgccggcttcttt
ttccacgctgccaggaaggatccccaggagggatacagaaccttggtagagaaccagccg
gtgtacatacacccgagcagcgcattgttccagcggcagccagactgggtcatctaccac
gaacttgtaatgacgacgaaggagtacatgcgggaggttaccgtgatcgacccgaagtgg
cttactgagctagccccgagattctacaagtcagcagacccaaccaagatgagcaagagg
aagaggcaggagaggattgaacccctgtacgacaggtaccatgagcccaactcctggcgt
ctcagcaagcgccgagcttga

DBGET integrated database retrieval system