KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0537500-01
Entry
Os02t0537500-01   CDS       T02163                                 

Gene name
Os02g0537500
Definition
(RAP-DB) Similar to E2F homolog.
  KO
K06620  transcription factor E2F3
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os02t0537500-01 (Os02g0537500)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    Os02t0537500-01 (Os02g0537500)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TMF_DNA_bd TrmB DHR10
Other DBs
RAP-DB: Os02t0537500-01
Position
chr02:complement(join(19872815..19873045,19871348..19871525,19871209..19871265,19870914..19870999,19870732..19870820,19870579..19870630,19870405..19870457,19870257..19870307,19870123..19870171,19869956..19870021,19869785..19869861,19869473..19869707,19869113..19869179,19868858..19868994))
AA seq 475 aa
MAGSGRPPAAQKKILQSLRPPLPFAASSRSPFAAPNDYHRFPAGGAAAAAASGSGGIGAG
GAGGGGDIEEGLVIRTPQKRKAPEESDVAESSDCMITSPGFAVSPMLTPVSGKAVKTSKS
KTKNNKAGPQTPTSNVGSPLNPPTPVGTCRYDSSLGLLTKKFINLLKQAPDGILDLNNAA
ETLEVQKRRIYDITNVLEGIGLIEKTLKNRIRWKGLDDSGVELDNGLSALQAEVENLSLK
EQALDERISDMREKLRGLTEDENNQRWLYVTEDDIKGLPCFQNETLIAIKAPHGTTLEVP
DPDEAGDYLQRRYRIVLRSTMGPIDVYLVSQFDEKFEDLGGGATPSGHANVPKHQPTEVF
NTTNAGVGQCSNSVAVDNNIQHSQTIPQDPSASHDFGGMTRIIPSDIDTDADYWLISEGD
VSITDMWKTAPDVQWDESLDTDVFLSEDVRTPSSHNQQPSAVGGPQMQVSDMHKP
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggggagtgggaggccgccggcggcgcagaagaagatcctgcagtcgctgcgcccg
ccgctgccgttcgccgcctcgtcgaggtcgcccttcgcggcgcccaacgactaccaccgc
ttccccgctggtggcgcggcggcggcggcggcgtctggttcgggtggcatcggcgcgggc
ggtgctggcggcggcggcgatatcgaggaggggctggtcatccggacgccgcaaaaaaga
aaagcaccagaagaaagtgatgttgctgagtctagcgactgtatgattactagccctgga
tttgctgtcagtccaatgctcactccagtctctgggaaagctgttaagacttccaagtca
aagactaagaacaacaaagctgggcctcagacacctacatcaaatgttggttcaccactt
aatcccccaactcctgttggtacatgccgttatgacagttcgttagggcttctcacaaag
aagttcataaatttgctgaagcaggctccggatggcattctagatttgaataatgctgca
gaaacactagaggttcaaaaacggcgtatatatgatattaccaatgtacttgaaggaata
gggttgattgaaaagacactcaagaacagaatccgttggaagggcttggatgattcagga
gtggaattagataatggtctttcagctttgcaggcagaagttgaaaatcttagtctgaag
gagcaagcattagatgagcgcataagtgatatgcgtgaaaaactaagaggtttaactgaa
gatgaaaacaatcaaagatggctctatgtgacagaagatgatatcaagggattaccctgc
tttcagaatgaaacactaattgcaataaaagctcctcatggcactacacttgaagtccca
gatcctgacgaggctggtgattatctccagagaagatatagaatcgtattaagaagtaca
atgggcccaatagatgtctacttagttagtcaatttgatgagaaatttgaggacttgggt
gggggtgcaacaccatcagggcatgcaaatgtaccaaaacatcaacctactgaagtcttc
aatacaacaaatgctggggttgggcaatgtagcaactcagttgctgtggacaataatatt
cagcacagccagacgattcctcaggatcctagtgcttcacatgattttggaggaatgaca
aggattatcccttcagatattgatactgatgctgattactggctcatatcagaaggggat
gtcagcattactgatatgtggaaaacagcaccagatgtgcagtgggatgagagcctggat
acggatgtcttcctatctgaagacgttagaacgccaagttcacacaatcagcagccatct
gcagtgggcgggccacagatgcaggtctcagacatgcataaaccctag

DBGET integrated database retrieval system