KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0633400-01Help
Entry
Os02t0633400-01   CDS       T02163                                 

Gene name
Os02g0633400
Definition
(RAP-DB) Similar to 61 kDa protein homolog.
  KO
K10739  replication factor A2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03030  DNA replication
dosa03420  Nucleotide excision repair
dosa03430  Mismatch repair
dosa03440  Homologous recombination
Module
dosa_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:dosa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Os02t0633400-01 (Os02g0633400)
   03420 Nucleotide excision repair
    Os02t0633400-01 (Os02g0633400)
   03430 Mismatch repair
    Os02t0633400-01 (Os02g0633400)
   03440 Homologous recombination
    Os02t0633400-01 (Os02g0633400)
DNA replication proteins [BR:dosa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Os02t0633400-01 (Os02g0633400)
DNA repair and recombination proteins [BR:dosa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Os02t0633400-01 (Os02g0633400)
   MMR (mismatch exicision repair)
     Os02t0633400-01 (Os02g0633400)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Os02t0633400-01 (Os02g0633400)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 SnoaL_4 PCI
Motif
Other DBs
RAP-DB: Os02t0633400-01
Position
chr02:complement(join(25408095..25408247,25407876..25407986,25407354..25407451,25407228..25407269,25407064..25407141,25406023..25406101,25405822..25405914,25405650..25405738,25404922..25404990,25404767..25404851))
AA seq 298 aa AA seqDB search
MYGVGVGGGGGGNYDGGGGNASSLFGGGGFMPSQATNAAEGTSGGGGGFPKSRNAQALLP
LTVKQIMDASQTNDDKSNFAVNGMEVSTVRLVGRMLNKLDRVTDVSFTLDDGTGRVPVNR
WENDSTDTKEMADIQNGDYVIVNGGLKGFQGKRQVVAYSVRRITNFNDVTHHFLHCVHVH
LELTRPKSQVNANTATGTPNQTMPRDSMAYNQSPLTNQASTFSAPQNTGTGTNMIDLVLN
VFHDPAVMNDDHGVGVDYVSRRLNLPEETVGKIIIDQVDLGHLYATIDDHHYKSTMNG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcgtcggcgtcggcggcggcggcggcgggaactacgatggcgggggagggaac
gccagctccctcttcggcggcggcggattcatgccctcgcaggcgaccaacgccgcggag
gggaccagcggcggcggcggcggcttccccaagagtcggaacgcccaggcgctgctcccg
ctcaccgtgaagcagatcatggacgcgtcccagaccaacgacgacaagtcgaattttgct
gtcaatggcatggaggtgtccacggttaggcttgtaggacgcatgttaaataagcttgat
cgggttacggatgtatcattcactcttgatgatggtacaggcagggtacctgtgaatcgc
tgggaaaacgatagcactgatactaaggagatggctgacattcagaatggtgactatgtt
attgtcaatggtggtctaaaaggttttcaagggaagcgtcaggtggttgcttactctgtg
aggcgtataaccaacttcaatgatgtaacacatcactttcttcactgcgttcatgtgcac
ttggagcttaccaggccgaagtcccaagtaaatgctaatacagcaacaggaactcctaac
caaactatgcctagggatagcatggcgtataaccaaagtccacttactaatcaggcctca
acattttctgcaccacaaaatactggtactggaacaaatatgatcgacttggtcttgaat
gtttttcatgacccagcagttatgaatgatgaccatggagtaggcgtagattatgtgagc
cgtcgtcttaatctaccagaggaaacagtcgggaaaatcattatagaccaagttgatctg
ggacatttgtatgccactatcgatgaccaccattacaagtccacaatgaatggttga

DBGET integrated database retrieval system