KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0704000-01Help
Entry
Os02t0704000-01   CDS       T02163                                 

Gene name
Os02g0704000
Definition
(RAP-DB) Carotenoid oxygenase family protein.
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00906  Carotenoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    Os02t0704000-01 (Os02g0704000)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     Os02t0704000-01 (Os02g0704000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
RAP-DB: Os02t0704000-01
Position
chr02:complement(29026243..29028159)
AA seq 638 aa AA seqDB search
MQRICPAHCSVTHSLTMKSMRLSYIPPAASAAPQSPSYGRKKNASAAPPSAAASTTVLTS
PLVTTTRTPKQTEQEDEQLVAKTKTTRTVIATTNGRAAPSQSRPRRRPAPAAAASAASLP
MTFCNALEEVINTFIDPPALRPAVDPRNVLTSNFVPVDELPPTPCPVVRGAIPRCLAGGA
YIRNGPNPQHLPRGPHHLFDGDGMLHSLLLPSPASSGDDPVLCSRYVQTYKYLVERDAGA
PVLPNVFSGFHGVAGMARGAVVAARVLTGQMNPLEGVGLANTSLAYFAGRLYALGESDLP
YAVRVHPDTGEVTTHGRCDFGGRLVMGMTAHPKKDPVTGELFAFRYGPVPPFVTYFRFDP
AGNKGADVPIFSVQQPSFLHDFAITERYAIFPEIQIVMKPMDMVVGGGSPVGSDPGKVPR
LGVIPRYATDESEMRWFEVPGFNIMHSVNAWEEAGGEELVLVAPNVLSIEHALEHMELVH
SCVEKVRINLRTGVVTRTPLAAGNFDFPVINPAFLGRRNRYGYFGVGDPAPKIGGVAKLD
FDRAGEGDCTVAQRDFGPGCFAGEPFFVADDVEGNGNEDDGYLVCYVHDEATGENRFVVM
DARSPDLEIVAEVQLPGRVPYGFHGLFVTQAELQSQHQ
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggatttgccctgctcactgctcggtcactcactcactcaccatgaagtccatg
aggctttcctacatccctcctgctgcttctgctgctccacagagccccagctatggcagg
aagaagaacgcctccgccgctccgccatcggctgccgcctccaccaccgttctcacctcc
ccgctggtgaccaccacccgcactccgaagcagaccgagcaagaggacgagcagttggta
gccaagaccaagactacgagaactgttattgctacgacgaatggcagggcggcgccgagc
cagtctcggcctcgccgccggcctgcccccgccgccgcggcgtcggccgcttcgctgccg
atgacgttctgcaacgcgctggaggaggtgatcaacacgttcatcgacccgccggcgctt
cggccggcggtggacccgcggaacgtgctgaccagcaacttcgtgcccgtggacgagctg
ccgccgacgccctgccccgtcgtgcgcggcgccatcccgcgctgcctcgccggcggcgcc
tacatccgcaacgggcccaacccgcagcacctcccgcgcgggccgcaccacctgttcgac
ggcgacggcatgctgcactccctcctcctcccgtcgcccgcgtcgtccggcgacgacccc
gtcctgtgctcgcgctacgtgcagacgtacaagtacctcgtggagcgcgacgccggcgcg
cccgtcctgcccaacgtcttctccggcttccacggcgtggccgggatggcgcgcggcgcc
gtcgtggcggccagggtcctgaccgggcagatgaatccgttggagggcgtcgggctcgcc
aacaccagcctcgcctacttcgccggccgcctctacgcgctcggcgagtccgacctcccc
tacgccgtgcgcgtccacccggacaccggcgaggtgaccacgcacggcaggtgcgacttc
ggcggccgcctcgtcatgggcatgaccgcgcaccccaagaaggaccccgtcaccggcgag
ctcttcgcgttccgctacggccccgtgccgccgttcgtgacgtacttccggttcgacccg
gccggcaacaagggcgccgacgtgcccatcttctccgtgcagcagccgtcgttcctgcac
gacttcgccatcaccgagcggtacgccatcttcccggagatccagatcgtgatgaagccc
atggacatggtggtgggcggcggctcgcccgtggggtcggaccccggcaaggtgccccgc
ctcggcgtgatcccgcgctacgccaccgacgagtcggagatgcggtggttcgaggtgccg
ggcttcaacatcatgcactcggtgaacgcgtgggaggaggccggcggcgaggagctggtg
ctggtggcgcccaacgtcctctccatcgagcacgccctggagcacatggagctagtgcac
tcctgcgtcgagaaggtgcgcatcaacctccgcaccggcgtcgtcacgcgcaccccgctc
gccgccgggaacttcgacttccccgtgatcaacccggctttcctcggccgccgcaacagg
tacggctacttcggcgtcggcgaccccgcgcccaagatcggcggcgtggccaagctcgac
ttcgaccgcgccggcgagggcgactgcaccgtggcgcagcgcgacttcgggcccgggtgc
ttcgccggcgaaccgttcttcgtggccgacgacgtcgagggcaacggcaacgaggatgac
gggtacttggtgtgctacgtccacgacgaggccaccggcgagaaccggttcgtggtgatg
gacgcgcggtcgccggacctggagatcgtcgcggaggtgcagctgcccggacgcgtcccc
tacggcttccatggcctgttcgtcacgcaggccgagctccagtcacagcaccaatga

DBGET integrated database retrieval system