KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0725900-01
Entry
Os02t0725900-01   CDS       T02163                                 

Gene name
Os02g0725900, HAP3K_SUBUNIT_OF_CCAAT-BOX_BINDING_COMPLEX, HAP3K/NK-YB1
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os02t0725900-01 (Os02g0725900)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os02t0725900-01 (Os02g0725900)
SSDB
Motif
Pfam: CBFD_NFYB_HMF
Other DBs
RAP-DB: Os02t0725900-01
Oryzabase: 8490
Position
chr02:complement(join(30192405..30192426,30191726..30192264))
AA seq 186 aa
MAGNKKRGGRNMDQVKKAAVRSDGVGGSATNAELPMANLVRLIKKVLPGKAKIGGAAKGL
THDCAVEFVGFVGDEASEKAKAEHRRTVAPEDYLGSFGDLGFDRYVDPMDAYIHGYREFE
RAGGNRRVAPPPPAAATPLTPGGPTFTDAELQFLRSVIPSRSDDEYSGSSPAIGGYGYGY
GYGKNM
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcagggaacaaaaagcgtggtggcaggaacatggatcaggtcaagaaggcggcagtg
agatcggatggggtgggaggtagtgcgaccaacgccgagctgccgatggccaacctcgta
cgcctgataaagaaggtgctcccagggaaagcgaagatcgggggagcagccaagggtctc
acccatgattgcgcggtggagttcgtcgggttcgtcggcgacgaggcctccgagaaggcc
aaggcagagcaccgccgcaccgtagcgccggaagactacttgggctcattcggcgacctt
ggcttcgatcgctacgtcgaccccatggatgcctacatccatggttaccgtgagtttgag
agggctggtgggaataggagggtggcgccgcctcctccggcggcagctacaccgctgacg
cccggtggaccgacattcactgacgcagagctgcagtttctccggtcggtgatcccctcc
agaagtgatgatgaatatagcggctcatcaccagccataggcggctatggctatggatat
ggctatggaaaaaatatgtga

DBGET integrated database retrieval system