KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0749700-00
Entry
Os02t0749700-00   CDS       T02163                                 

Gene name
Os02g0749700
Definition
(RAP-DB) Similar to cDNA, clone: J065097H05, full insert sequence.
  KO
K05909  laccase [EC:1.10.3.2]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Os02t0749700-00 (Os02g0749700)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.2  laccase
     Os02t0749700-00 (Os02g0749700)
SSDB
Motif
Pfam: Cu-oxidase_3 Cu-oxidase_2 Cu-oxidase
Other DBs
RAP-DB: Os02t0749700-00
Position
chr02:complement(join(31517558..31517665,31517296..31517447,31516955..31517199,31515742..31516845,31515518..31515648))
AA seq 579 aa
MGTAKLPALLWLLAGVVLALAVNPAHGAKTRHYDFFITETNYTRLCHEKSILTVNGQFPG
PTIYARKGDLVIVNVHNNGNKNITIHWHGVDQPRNPWSDGPEFITQCPIRPGGNFTYQVI
LSEEEGTLWWHAHSDFDRATVHGAIVIHPKRGTTFPFKKPDKEIPVILGEWWNDDIEHVL
DKAQLLGGDVDPSNANTINAQPGDMFPCSRDDTFKVAVQQGNTYLLRIINAGLTNDMFFA
IAGHRLTVVGIDARYTKPLTVDYIMIAPGQTMDVLLEAKRTLGSNSRYYMAARTFITLPL
DTIPFNNSTATAIVEYTDSVTARPVGPPEFPVQLPAIKDENAAMAFVTQLRSLGNQEHPV
HVPTHVDEHMLIDIDINVLPCDPTNMAEKCKEGPQGNRFAASLNNVSFQSPAIDVLDAYY
YSSGHGVYEEDFPNKPTAFVDPPVNNGSGPLMTKRGTKVKVLEYGTVVEVVFHDLSSENH
PMHLHGFAFYVVGRGNGTFDESRDPATYNLVDPPFQNTVSVPRSGWAAIRFRADNPGVWF
MHCHFDRHVVWGMDTVFIVKDGKTPQAQMLPRPPNMPQC
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgggaacagccaagttacctgcattgctttggttactagcaggcgtggtgttagcactt
gcagttaaccccgctcatggcgccaagactcgccactacgatttcttcattacggagacc
aactacacgaggctctgccacgagaagagcatcctcaccgtgaacgggcagttccccggc
ccgaccatctacgcgcgcaagggcgacctcgtcatcgtcaacgtccacaacaacgggaac
aaaaacatcaccatccactggcacggcgtggaccagccacggaacccgtggtcggacggg
ccggagttcatcacgcagtgcccgatccggccgggcggcaacttcacctaccaggtgatc
ctgtccgaggaggagggcacactgtggtggcacgcgcacagtgacttcgaccgcgccacc
gtccacggcgccatcgtcatccaccccaagcgcggcaccaccttccccttcaagaagcca
gacaaggagatacccgtcatccttggtgagtggtggaatgacgacatagagcacgtgctc
gacaaggcgcagctcctcggcggagacgtggatccgtccaacgccaacaccatcaacgcc
cagcctggggacatgttcccctgctccagggacgacacgttcaaagtggccgtgcagcag
ggcaacacgtacctgcttaggatcatcaacgctggactcaccaacgacatgttcttcgcc
atcgcggggcaccgcctcaccgtggtcgggatcgacgcccgctacaccaagccgctcaca
gtcgactacatcatgatcgcgcctggccagaccatggacgtgctcctcgaggccaaacgc
accttgggatccaacagccggtattacatggccgcgagaacgtttatcacgttaccgctc
gacactatccctttcaacaatagcactgccacggctatcgtggagtacacggacagcgtc
accgcgaggccggtcgggccaccggaattccccgtccagctgccggccatcaaggatgag
aacgcggcgatggcgttcgtcacgcagctcagatcattaggcaaccaggaacacccggtg
cacgtaccgacacatgtcgatgagcacatgctcatcgacattgacatcaacgttcttccc
tgcgaccccaccaacatggcagagaagtgcaaagaaggaccccaaggcaaccggttcgcg
gcgagcctcaacaatgttagcttccagagcccggctatcgacgtcctcgacgcctactac
tatagctctggccacggcgtgtacgaggaggacttccccaacaagccgacagccttcgtc
gacccgcccgtcaacaacggcagtgggcccttgatgacgaagcgtggcaccaaggtgaag
gtgctggagtacggcactgtggtagaggtggtgtttcatgacttgtccagcgagaaccac
cctatgcatctgcatggcttcgccttctacgtcgtgggacgagggaacggcaccttcgac
gagagcagggacccggcgacctacaacctcgttgacccgccgttccagaacacggtctct
gtgcccaggtccggctgggccgcaatccgcttccgagcagacaatccaggtgtgtggttc
atgcattgccattttgatcgccacgtggtgtgggggatggacactgtgttcatcgtgaag
gacggcaagacaccgcaggctcagatgctgcctcgtcctccaaacatgcctcagtgctaa

DBGET integrated database retrieval system