KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0757900-01
Entry
Os02t0757900-01   CDS       T02163                                 

Gene name
Os02g0757900
Definition
(RAP-DB) Similar to Poly(A)-binding protein II-like.
  KO
K14396  polyadenylate-binding protein 2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    Os02t0757900-01 (Os02g0757900)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dosa03019]
    Os02t0757900-01 (Os02g0757900)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     Os02t0757900-01 (Os02g0757900)
SSDB
Motif
Pfam: RRM_1 RRM_5 VirE Cep57_MT_bd Casc1
Position
chr02:complement(join(31920418..31920522,31920227..31920326,31919196..31919266,31916835..31917026,31916603..31916724,31916472..31916520))
AA seq 212 aa
MDEEEHEVYGQEIPEDGDMDGADVDMASGGDDAAKLQELDQMKRRLKEMEEEAAALRDMQ
AKVAKEMQGGDPSASTAEAKEQVDARSVYVGNVDYACTPEEVQQHFQACGTVNRVTILTD
KFGQPKGFAYVEFLEQEAVQEALNLNESELHGRQIKVAPKRTNVPGMKQRPPRGYNPYHG
YPYRSYGAPYFPPYGYGRVPRFRRPMRYRPYF
NT seq 639 nt   +upstreamnt  +downstreamnt
atggacgaggaggagcacgaggtgtacgggcaagagatcccggaggacggggacatggac
ggcgcggacgtcgacatggcctccggcggggacgacgccgcgaagctgcaggagctcgac
cagatgaagcgaaggctgaaggagatggaggaagaggccgcggccctccgcgacatgcag
gccaaggtcgccaaggagatgcaaggaggagatcctagcgcgtctacagctgaggcaaag
gagcaggtggatgctcgatctgtgtatgttggaaatgttgattatgcatgtaccccagaa
gaagtgcagcagcattttcaagcgtgtggcacagtcaatagagtgacgatcttaactgac
aagtttggacagccaaaaggttttgcttatgtggaatttctggaacaagaagcagttcag
gaggctctgaatttgaatgaatctgaactgcatggtcgtcagataaaggtggcaccaaag
aggactaatgtccctgggatgaagcagcgtccaccgcgtggatacaatccttatcatggt
tacccatatagatcgtatggggccccatatttcccaccatatggttacgggagagtcccc
agattccgccgtccaatgcgctacaggccatacttttga

DBGET integrated database retrieval system