KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0776400-01
Entry
Os02t0776400-01   CDS       T02163                                 

Gene name
Os02g0776400
Definition
(RAP-DB) Similar to nuclear transcription factor Y subunit A-3.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os02t0776400-01 (Os02g0776400)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os02t0776400-01 (Os02g0776400)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os02t0776400-01
Position
chr02:complement(join(32798183..32798225,32795973..32796079,32795803..32795871,32795004..32795177,32794451..32794870))
AA seq 270 aa
MLLPSSSSYSYASKGDSFRRTVDGPMRSTLTFDNNHSVVPSQNIDYGQPMACISYPYNDS
GSGVWASYSSRSVFHPQIVGGGTSPRVPLPSLEIADDGPIYVNPKQYHGILRRRQLRAKL
EAQNKLVKTRKPYLHESRHRHAMKRARGTGGRFLNTKQLQLQQQSHTTSTKTTTDSQNSS
GSVHLRLGGGAIGDQTPFPFKAMDSQANIKRAAASASTFTVTSAAQKDDAFFDRHGHHLS
SFSGHFGQASAQGGVGSMHNGSQQRVPAMR
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcttctcccctcatcgtcttcttattcctacgcctccaaaggtgactccttcaggaga
actgttgatggtcctatgaggtcaacgttgacttttgataataatcattctgtagtgcca
agtcaaaacattgattacggccagccaatggcttgcatttcatacccatacaacgattct
ggttcaggagtttgggcatcctacagttcacgctcggtgttccatcctcaaattgtggga
ggaggcacatcgccaagagttcccttgccctccctggagatagcagatgatgggcccata
tatgtcaatcccaaacaatatcatggaattcttcgcagaagacaactgcgtgctaagtta
gaggcccagaataagctcgtcaaaacccgaaagccttaccttcacgaatctcggcatcgc
catgcaatgaagagggctaggggcactggtgggcgattcctgaataccaagcagctccag
ctgcagcaacagtctcacactacctccaccaagaccaccacagacagccaaaattcttca
ggttcagtccatctacggctaggtggtggcgcaatcggagatcaaactccatttccgttc
aaagcaatggattcacaagctaacatcaagagagctgcagcttctgcttccaccttcact
gtaacttctgcggcacagaaagacgacgccttcttcgaccgccatggccaccatctcagt
agcttctccggccattttggccaggcaagcgcacaaggtggcgtcggcagcatgcataac
gggtcacagcagagggttcctgctatgagatga

DBGET integrated database retrieval system