KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0817700-02
Entry
Os02t0817700-02   CDS       T02163                                 

Gene name
Os02g0817700
Definition
(RAP-DB) Similar to 3-ketoacyl-CoA thiolase (Fragment).
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00071  Fatty acid degradation
dosa00280  Valine, leucine and isoleucine degradation
dosa00592  alpha-Linolenic acid metabolism
dosa01040  Biosynthesis of unsaturated fatty acids
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01212  Fatty acid metabolism
dosa04146  Peroxisome
Module
dosa_M00087  beta-Oxidation
dosa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Os02t0817700-02 (Os02g0817700)
   00592 alpha-Linolenic acid metabolism
    Os02t0817700-02 (Os02g0817700)
   01040 Biosynthesis of unsaturated fatty acids
    Os02t0817700-02 (Os02g0817700)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Os02t0817700-02 (Os02g0817700)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Os02t0817700-02 (Os02g0817700)
Enzymes [BR:dosa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Os02t0817700-02 (Os02g0817700)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Other DBs
RAP-DB: Os02t0817700-02
Position
chr02:complement(join(35084989..35085069,35084804..35084880,35084130..35084214,35083886..35084012,35083688..35083786,35083518..35083585,35083328..35083435,35083161..35083238,35082882..35083014,35082664..35082760,35082071..35082194,35081874..35081982,35081645..35081728,35081449..35081525))
AA seq 448 aa
MEKAIDRQRVLLAHLLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTPIC
KAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAFYA
GVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNPKV
NEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATAAGKFKDEIVPVPT
KIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPVFRKDGTTTAGNSSQVSDGAGAVLL
MRRDVAMKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFELNEA
FASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVT
MCIGSGMGAAAVFERGDSVDQFSNVRHH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggagaaggcgatcgatcgccagcgcgtcctcctcgcccacctcctcccctcctcctcc
tccgaccaatcgctcctctccgcgtcggcgtgcgccgccggggacagcgccgcctaccag
aggacttccgcctacggggacgacgtcgtcgtcgtcgctgcctacaggacacccatatgc
aaggccaagcgaggaggtttcaaggatacatacccagaggaccttcttactgttgttcta
aaggctgttctggacaacactaagatcaaccctggtgaaattggtgacattgtagttggc
acggtgctaggtccaggctcgcagcgtgcaatcgagtgcagggctgcggctttctatgct
ggagttcccgaaaacgttcctgttagaactgtcaaccggcaatgttcctctggattacag
gcagtggctgatgttgccgcggccattaaagctgggttctacgacatagggattggtgca
ggcctggaatccatgtcagtaaatgctatgggttgggaaggacaagtaaaccctaaagta
aatgaagtccagaaagcacaggattgtcttttgcccatggggataacgtccgaaaatgtt
gcgcaccgatatggtgtaacaagacaagagcaggatcaggctgctgctgagtctcatagg
agggctgctgcagccacagctgctgggaaattcaaagatgagattgttccggtgcctaca
aagattgttgaccccaagactggagaggaaaagaaagttgtgatatcagttgatgatgga
attaggccagggaccacagcatctggattggcaaagcttaaaccagttttccggaaggat
ggtaccacaactgcaggcaactctagtcaagtgagcgatggtgctggagctgttcttctc
atgaggagggacgtagcgatgaagaagggacttcctattcttggtgttttcaggagcttt
gctgctgttggagtagatcctgctgttatgggtgttggtcctgcagtagcaataccagct
gcagtgaagtctgctggactccagattgaagacattgatctgtttgaattgaatgaggcc
ttcgcttcgcagttcgtgtattgctgcaacaagctgggactggacaggtcaaaagtaaac
gtgaatggaggcgcaatcgccctaggacatcctcttggtgcaacaggtgcccggtgcgtc
gcaactcttctgaatgaaatgaagcgccggggcagggactgcagattcggtgttgtcacc
atgtgcattggatctggcatgggggcagcagctgtgtttgagcggggtgactcggtcgac
caattctcaaacgtgcgccaccattag

DBGET integrated database retrieval system