KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0174900-01
Entry
Os03t0174900-01   CDS       T02163                                 

Gene name
Os03g0174900
Definition
(RAP-DB) Similar to RAPB protein.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os03t0174900-01 (Os03g0174900)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os03t0174900-01 (Os03g0174900)
SSDB
Motif
Pfam: CBFB_NFYA DUF5547
Other DBs
RAP-DB: Os03t0174900-01
Position
chr03:complement(join(4003529..4003711,4003371..4003439,4002754..4002924,4002371..4002577))
AA seq 209 aa
MQSLFASTLLKLCDISFLLVLMLGNLDGYTKSDEGKMMSALSLGKSETVYAHSEPDRSQP
FGISYPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAI
LRRRQLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQQPEASDGGTPRL
VSANGVVFSKHEHSLSSSDLHHRRAKEGA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcaaagtttgtttgcatctacactactgaagttatgtgacatttcttttcttcttgta
ctaatgctaggtaatcttgatggttacacgaagagtgatgaaggtaagatgatgtcagct
ttatctctgggcaaatcagaaactgtgtatgcacattcggaacctgaccgtagccaaccc
tttggcatatcatatccatatgctgattcgttctatggtggtgctgtagcgacttatggc
acacatgctattatgcatccccagattgtgggcgtgatgtcatcctcccgagtcccgcta
ccaatagaaccagccaccgaagagcctatttatgtaaatgcaaagcaataccatgcgatt
ctccgaaggagacagctccgtgcaaagttagaggctgaaaacaagctggtgaaaaaccgc
aagccgtacctccatgaatcccggcatcaacacgcgatgaagagagctcggggaacaggg
gggagattcctcaacacaaagcagcagcctgaagcttcagatggtggcaccccaaggctc
gtctctgcaaacggcgttgtgttctcaaagcacgagcacagcttgtcgtccagtgatctc
catcatcgtcgtgcgaaagagggcgcttga

DBGET integrated database retrieval system