KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0181100-01
Entry
Os03t0181100-01   CDS       T02163                                 

Gene name
Os03g0181100, JASMONATE_ZIM-DOMAIN_PROTEIN_4, JAZ4
Definition
(RAP-DB) Tify domain containing protein.
  KO
K13464  jasmonate ZIM domain-containing protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    Os03t0181100-01 (Os03g0181100)
SSDB
Motif
Pfam: tify Jas_motif
Other DBs
RAP-DB: Os03t0181100-01
Position
chr03:4249082..4249645
AA seq 187 aa
MAMEGKSRRFAVACGVLSQYVRAEQKMAAAAGAAPARAVTTLSLMPGAEVVVEEEERREV
GEEEAGPATAPAAPLTIFYGGRMVVFEDFPADKAAEVMRMASSGMAAAPAQREGAALADM
PIMRKASLQRFFAKRKDRLAATTPYARPSPAETKASEPEEKKTPTSWLDLAASASAAARR
DSLTIAL
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcgatggaggggaagagcaggaggttcgcggtggcgtgcggggtgctcagccagtac
gtgagggcggagcagaagatggcggcggcggcgggggcggcaccggcgagggcggtgacg
acgctgagcctgatgcctggggcggaggtggtcgtcgaggaggaggagcggagggaggtt
ggggaggaggaggcggggccagcgacggcgccggccgcgccgctgaccatcttctacggt
gggaggatggtcgtcttcgaggacttccccgcggacaaggcggcggaggtgatgcgcatg
gcctcctccgggatggcggcggcgccggctcagcgggagggcgccgcgctcgcggacatg
cccatcatgaggaaggcgtcgctgcagcggttcttcgccaagcgcaaggaccgcctcgcg
gcgaccaccccctacgcccgcccgtcgccggcggagaccaaggcctccgagccggaggag
aagaagacgcccacctcatggctggacctcgccgcctccgcctccgccgccgcgcgccgt
gacagcctcaccatcgcgctgtga

DBGET integrated database retrieval system