KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0208900-01Help
Entry
Os03t0208900-01   CDS       T02163                                 

Gene name
Os03g0208900
Definition
(RAP-DB) Similar to ADP-glucose pyrophosphorylase (Fragment).
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00051  Fructose and mannose metabolism
dosa00520  Amino sugar and nucleotide sugar metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Os03t0208900-01 (Os03g0208900)
   00520 Amino sugar and nucleotide sugar metabolism
    Os03t0208900-01 (Os03g0208900)
Enzymes [BR:dosa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Os03t0208900-01 (Os03g0208900)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Fucokinase CTP_transf_3
Motif
Other DBs
RAP-DB: Os03t0208900-01
Position
chr03:complement(join(5685099..5685156,5684885..5684982,5684690..5684790,5684479..5684557,5684225..5684285,5684071..5684117,5683887..5683979,5683645..5683735,5683173..5683221,5682137..5682253,5681912..5682059,5681658..5681750,5681515..5681584,5681156..5681197,5680942..5681042))
AA seq 415 aa AA seqDB search
MAASEQRVVAVIMVGGPTKGTRFRPLSLNVPKPLFPLAGQPMVHHPISACRRIPNLAQIY
LVGFYEEREFALYVSSISNELRVPVRYLREDKPHGSAGGLYSFRDYIMEDSPSHIVLLNC
DVCSSFPLPDMLEAHKKYGGMGTLLVNKVSAESANQFGELVADPETNELLHYTEKPETFV
SDLINCGVYIFTPNIFNAIEDVLKQKKDRANLRRVSSFEALHSATKALPADYVRLDQDIL
SPLAGKKELYTYQTLDFWEQIKTPGMSLRCSGLYLSQFRHTSPHLLASGDGKRSATIIGD
VYIHPSAKVHPTAKIGPNVSISANARIGAGARLIHCIILDDVEIMENAVVIHSIVGWKST
VGKWSRVQGEGDHNAKLGITILGEAVDVEDEVVVVNSIVLPNKTLNVSVQEEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccgagcagcgcgtcgtcgccgtcatcatggtcggcgggccgaccaaaggg
acgaggttccggccgctgtcgctgaacgtgccgaagccgctgttcccgctcgccggccag
cccatggtgcaccacccaatctccgcctgccgccgcatccccaacctggcgcagatatac
ctcgtcgggttctacgaggagcgggagttcgcgctctacgtctcctcgatctccaacgag
ctcagggtccccgtcaggtacctgagggaggataagccccatggatcagctggagggctc
tacagcttcagggattacatcatggaggacagtccgtcgcacattgttttgttgaactgt
gatgtatgctcgagcttccccctgccagacatgctcgaggcccacaaaaagtatggtgga
atgggtactttattagtcaataaggtctccgcagagtctgcaaaccaatttggtgagctc
gtagctgaccctgaaacaaatgaactgttacactacacagaaaagccagagacttttgtg
agtgatctcataaattgtggggtctatatatttacacccaatatctttaatgccatcgag
gatgtcttaaaacagaagaaagacagagctaacctgcgccgtgtctctagttttgaagct
cttcactcggcaacaaaagcacttccagcagactatgttaggttagatcaagatatttta
tcccctctagcaggaaagaaggaactttacacataccagactctcgacttttgggaacag
atcaagaccccagggatgtctttgagatgctctggcctatatctttctcagttccgccat
acctctcctcatcttttagcctcaggagatggcaaaaggagtgccactattataggtgat
gtgtacattcatccgtctgcaaaggttcatccaacagcaaagatcggtcctaatgtctcg
atatcagcaaatgcacgtattggagctggagccaggcttattcattgcattattctggat
gatgttgaaattatggagaatgcagttgttatacactcaattgtggggtggaagtcaacc
gtaggaaaatggtcacgtgtacagggtgaaggtgaccataacgccaaactcggtatcaca
attcttggtgaagccgttgatgttgaagatgaagtggttgtagttaacagcattgtgctc
cccaataaaactctcaatgtcagtgtgcaagaggagatcatattatga

DBGET integrated database retrieval system