KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0255500-01Help
Entry
Os03t0255500-01   CDS       T02163                                 

Gene name
Os03g0255500
Definition
(RAP-DB) Similar to Phosphoenolpyruvate carboxykinase 4 (EC 4.1.1.49) (Fragment).
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00020  Citrate cycle (TCA cycle)
dosa00620  Pyruvate metabolism
dosa00710  Carbon fixation in photosynthetic organisms
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01200  Carbon metabolism
Module
dosa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
dosa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os03t0255500-01 (Os03g0255500)
   00020 Citrate cycle (TCA cycle)
    Os03t0255500-01 (Os03g0255500)
   00620 Pyruvate metabolism
    Os03t0255500-01 (Os03g0255500)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Os03t0255500-01 (Os03g0255500)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Os03t0255500-01 (Os03g0255500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33
Motif
Other DBs
RAP-DB: Os03t0255500-01
Position
chr03:complement(join(8223633..8223877,8222011..8222216,8221757..8221910,8221558..8221642,8221366..8221466,8220823..8221121,8220401..8220574,8220244..8220309,8219967..8220145,8219686..8219855,8219433..8219601,8219186..8219329))
AA seq 663 aa AA seqDB search
MASTPNGLARIETHGAKTKKHENGICHDDSSAPVRAQTIDELHSLQRKRSAPTTPIKDGA
SSPFAAALSEEERQRQQLQSISASLASLTRETGPKVVRGDPARKGEAAAKGAPSPHPQPV
HHHHPHVTPTIAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSTGALATLSGAKTG
RSPRDKRIVKDEASAQELWWGKGSPNIEMDEHTFLTNRERAVDYLNSLDKVFVNDQFLNW
DTENRIKVRIISARAYHSLFMHNMCIRPTEEELEEFGTPDFTIYNAGQFPCNRYTHYMTS
STSVDINLARREMVILGTQYAGEMKKGLFGVMHYLMPRRGILSLHSGCNMGKQGDVALFF
GLSGTGKTTLSTDHNRLLIGDDEHCWSDTGVSNIEGGCYAKCIDLSQEKEPDIWNAIKFG
TVLENVVFDEHTREVDYTDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGV
LPPVSKLNLPQTMYHFISGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYAAMLAE
KMQKYGATGWLVNTGWSGGRYGVGKRIRLPYTRKIIDAIHSGELLTANYKKTEVFGLEIP
TEIDGIPSEILDPINTWTDKGAYKETLLKLAGLFKKNFEVFANYKIGGDSSLTDKILAAG
PNF
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacgccgaacgggctggcgcggatcgagacgcacggggcgaagacgaagaag
cacgagaacgggatatgccacgacgacagctcggcgccggtgcgggcgcagaccatcgac
gagctccactcgctgcagcggaagcggtcggcgcccaccacgcccatcaaggacggcgcc
tcctcgcccttcgccgccgccctctccgaggaggagcgccagcgccagcagctccagtcc
atcagcgcgtcgttggcgtcgctgacgcgtgagaccgggccgaaggtcgtcaggggagat
ccggcgaggaagggcgaggccgcggcgaagggcgcgccgtcgccgcacccgcagccggtg
caccaccaccacccgcacgtcaccccgaccatcgccgtcagcgacagctccctcaagttc
acccatgtgctctacaacctctcgcctgctgagctgtacgagcaggcgatcaagtacgag
aaggggtcgttcatcacgtccaccggcgcgctggcgacgctgtccggcgccaagaccggc
cggtcgccgagggacaagcgcatcgtcaaggatgaggcctccgcgcaggagctttggtgg
ggcaagggttcgcccaacatcgagatggacgagcacactttcctcaccaacagggagagg
gccgtcgactacctcaactcccttgacaaggtgtttgtgaacgaccagttcctgaactgg
gacacggagaaccggatcaaagtccgtatcatctcggccagggcgtaccactcgctcttc
atgcacaacatgtgcatccggccgacggaggaggagctggaggagttcggcacgccggac
ttcaccatatacaacgccgggcagttcccctgcaaccggtacacgcactacatgacgtcg
tcgacgagcgtagacatcaacctcgctaggagggagatggtgatcctcggcacgcagtac
gccggggagatgaagaaggggctcttcggggtgatgcactacctcatgcccaggaggggc
atcctctccctgcactccggctgcaacatgggcaagcagggcgacgtcgccctcttcttt
ggactgtcaggtactggaaagactactctgtcaactgaccacaacaggctgctgatcggc
gacgatgagcactgctggagtgacactggcgtgtccaacatcgagggtggttgctatgcc
aagtgcatagacttgtcacaggagaaagagcctgatatttggaatgccatcaagtttggg
accgtgttggagaatgtcgtctttgatgagcacacccgtgaagttgattacaccgacaaa
tctgtcaccgagaacacgcgcgctgcttaccctatcgagtacatccccaacgccaagata
ccgtgcgtcgggccacacccgaagaacgtcattctcctggcatgcgacgctttcggcgtc
ctccctcctgtcagcaagctaaaccttccacagaccatgtaccacttcatcagtggctac
actgctctggttgccggcacggaggatggcatcaaggagccgcaggctacgttctctgct
tgcttcggtgcagcgttcatcatgctccacccgaccaagtacgccgccatgctcgccgag
aagatgcagaagtatggcgccaccgggtggctcgtcaacaccggttggtccggtggaagg
tacggagttggcaagcggatcaggctgccgtataccaggaagatcatcgacgccatccac
tccggtgagctcctcaccgccaactacaagaagacggaggtgtttggcctggagatcccc
actgaaatcgacggcatcccgtctgaaatcctcgacccgatcaacacctggacggacaag
ggcgcgtacaaggagacgctcctgaagctggctggcctgttcaagaagaacttcgaggtg
ttcgccaactacaagatcgggggagacagcagcctgacagacaagatcctcgctgctgga
ccaaacttttga

DBGET integrated database retrieval system