KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0277600-01
Entry
Os03t0277600-01   CDS       T02163                                 

Gene name
Os03g0277600
Definition
(RAP-DB) Similar to (clone wusl1032) mRNA sequence.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Stress-antifung
Other DBs
RAP-DB: Os03t0277600-01
Position
chr03:complement(join(9422490..9422833,9421942..9422395))
AA seq 265 aa
MAFSSKACRCLVLMSFALLPLSMAMDSIGSYCSGNSLAGNSKAVASINSVLTDLVAKGST
GGGFATSSAGKANNVIYGLAQCRGDVSTSDCQACLASAANQILTSCNYQSDSRIWYDYCF
MRFENENFIGQTDTDAGVILVNVQAMDNGKAFQKAVGKVMGKATSQASQAGSGGLGRTKD
QYTPFINIYGLAQCTQDLSPLACAQCLSTAVSRFGQYCGAQQGCQINYSSCRVRYEIYPF
YFPLATSARSATTDMTKYTKIVVHR
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcattcagtagcaaagcttgccgttgcttggtgctcatgtcatttgccttgctccca
ctgagcatggccatggactccattggcagctactgttcagggaacagcttggccggcaac
agcaaggccgtggcaagcatcaactccgtcctcaccgacctcgtcgccaagggctccacc
ggcggcggcttcgccacgtcctccgccgggaaagccaacaacgtcatctacggtctcgcg
caatgccgcggcgacgtctccaccagcgactgccaggcctgcctcgcctccgccgccaac
cagatcctcaccagctgcaactaccaatccgactcaagaatatggtatgactactgcttc
atgcggttcgagaacgagaacttcatcgggcagacggacacagatgccggggtgattctt
gtgaacgtgcaggcgatggataacggcaaggcgttccagaaggcggtagggaaggttatg
ggcaaggcaacgtcgcaggcatcacaggctgggagtggtgggctgggtaggacgaaggat
cagtacacgccgttcatcaacatctacgggctggcacagtgcacacaggacttgtcaccg
ctggcttgcgcacagtgtctgtcaacggcggtgtcaaggttcggtcaatactgcggcgca
caacagggatgtcagattaactacagtagctgcagggtgcgctacgagatctatcccttc
tacttcccgctcgccaccagcgcacgcagcgccaccactgacatgaccaagtacaccaag
atcgttgtgcaccgctaa

DBGET integrated database retrieval system