KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0328000-01Help
Entry
Os03t0328000-01   CDS       T02163                                 

Gene name
Os03g0328000
Definition
(RAP-DB) Dedicator of cytokinesis family protein.
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os03t0328000-01 (Os03g0328000)
Membrane trafficking [BR:dosa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    Os03t0328000-01 (Os03g0328000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
RAP-DB: Os03t0328000-01
Position
chr03:join(12006548..12007138,12007257..12007511)
AA seq 281 aa AA seqDB search
RFGKLNKKEYVFREPRDVRLGDIMEKLSHIYEAKMDGNHTLHIIPDSRQVNADELQPGVC
YLQITAVDPVMEDEDLGSRRERIFSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLEDQWK
RRTVLQTEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQL
PRLQSLQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRA
IRVHFRLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
cggtttggcaaactcaacaaaaaggagtatgtgttcagagagccaagagatgttcgtctt
ggtgacataatggagaagcttagtcatatctatgaggctaaaatggatggcaatcacacc
ttacacatcattccggattcgagacaagtcaacgctgatgagttgcaacctggtgtctgc
tatctgcagataactgctgttgatcctgtaatggaggatgaggacctagggagtagaagg
gaaaggattttctctttatctactggtactgtccgggcccgtgtgttcgaccgttttctt
tttgatacaccattcacaaagaatggaaaaacacaaggtggccttgaagatcagtggaag
aggcgcacagtactccagacagagggttcctttcctgctttggtgaatcgtctgttagtg
atcaaatcagaatctctagagttttctcctgttgagaatgcgattggaatgatcgagaca
aggacagctgccttgcgaaatgaactagaagaaccacgcagttcggaaggtgaccaactc
ccaagactccaaagcctgcagaggatactccaaggaagtgtggctgttcaggtaaatagt
ggtgtattaagtgtgtgcactgcattcttatctggtgagcccgcaactaggctccgatct
caagaactgcagcagctcatcgctgcattgctggaattcatggccgtctgcaagcgcgca
atccgtgtgcattttagattgataggggaagaagaccaggaattccacactcaactagtc
aatggctttcagtcgctcacagctgagctttcacactatattcctgcaattctttcagag
ctataa

DBGET integrated database retrieval system