KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0364400-01
Entry
Os03t0364400-01   CDS       T02163                                 

Gene name
Os03g0364400
Definition
(RAP-DB) Similar to Phytosulfokine receptor-like protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
RAP-DB: Os03t0364400-01
Position
chr03:join(14207170..14207640,14207754..14207889,14207998..14208134,14208205..14208804)
AA seq 447 aa
MPPRQWRPMLASATKCCAAEDAVVAVDGSGGGGGLARCRPARSEFSRRLASFRKLSSMTN
SPASSVAGAAEGGKDDGEEGGGGGGGVSGPLQLYSFSFSELRSITHDFSSSYLLGEGGFG
AVHKGFVDAGMRPGLLPQPVAVKQLDIAGLQGHREWLAEVIFLGQFRHPHLVKLLGYCCE
DEERLLVYEFMPRGSLENHLFKRISATVPWGTRLKIAIGAAKGLAFLHGASTPVIYRDFK
ASNILLDSEFTAKLSDFGLAKMGPEGSETHVTTRVMGTHGYAAPEYVMTGHLNIKSDVYS
YGVVLLELLTGRRAMEHVRGRSLHADQVVKIVDWTRPYLGSSRRLRCIMDPRLAGHYSVK
AARAVAHLAVQCTSPQPRDRPRMAAVVDALERLQGFKDMAVTVGLWPTNAPVAGRNAISA
KIRAEVRGAGSGGGAASRRRSASAKLP
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgccgccgaggcagtggaggccgatgctggcgtcggcgaccaagtgctgcgcggcggag
gacgcggtggtggcggtggatggcagcggcggcgggggcggcctcgcgcggtgcaggccg
gcgcggtccgagttctcacggaggctggcgtcgttccggaagctgtcgtcgatgaccaac
agcccggcgtcgtccgtcgcgggggcggcggagggggggaaagacgacggcgaggagggg
ggcggcggcggtggcggcgtgtccggcccgctgcagctctactccttcagcttctccgag
ctccggtccatcacgcacgacttctccagcagctacctgctcggggagggcggcttcggc
gccgtccacaagggcttcgtcgacgccggcatgcgccccggcctcctgccccagcccgtc
gccgtcaagcagctcgacatcgccggcctccagggccaccgggagtggctggcggaggtg
atcttcttggggcagttccggcacccgcacctggtgaagctgctgggctactgctgcgag
gacgaggagcgcctcctcgtctacgagttcatgccgcgcggcagcctcgagaaccacctc
ttcaagaggatatcggcgacggtgccgtggggcacgcgtctgaagatcgccatcggcgcc
gccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgcgacttcaag
gcctccaacatcctcctcgactcggagttcacggcgaagctgtcggacttcgggctggcg
aagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggcacgcacggg
tacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgacgtgtacagc
tacggcgtcgtgctcctggagctcctgacggggcggcgcgccatggagcatgtcaggggg
aggagcctccacgccgaccaggtggtcaagatcgtcgactggacccgcccctacctcggc
agcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactactccgtcaag
gccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccgcgcgaccgc
ccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaaggacatggcc
gtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgccatctccgcc
aagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcgcggcggcgg
agcgcctccgccaagctgccctga

DBGET integrated database retrieval system