KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0389000-00
Entry
Os03t0389000-00   CDS       T02163                                 

Gene name
Os03g0389000
Definition
(RAP-DB) Similar to LOL3.
  KO
K22684  metacaspase-1 [EC:3.4.22.-]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dosa01002]
    Os03t0389000-00 (Os03g0389000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Os03t0389000-00 (Os03g0389000)
Peptidases and inhibitors [BR:dosa01002]
 Cysteine peptidases
  Family C14: caspase family
   Os03t0389000-00 (Os03g0389000)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
RAP-DB: Os03t0389000-00
Position
chr03:complement(join(15564465..15564927,15563927..15564379,15563627..15563830,15563374..15563528))
AA seq 424 aa
MGCNCLVGKGGNTRPAATTSARPSSSRCAHCGAGLAVPRPGPGGAAAVTTVRCALCHRMT
CVDRRGGRDLGGGGGGGALEASSSSWAPAEASFLRRDAPSGYPFVPGRKRALLVGVSYKG
SSYELEGTVNDVDCMRRLLGESFGFPADSILVLTAGRGRPVEVADEGEPAGGDAVAGGRV
RRRRLAGVPLLRPRRAEAGRERRRGGRLQRGALPRGLRAERQDPRRRDQRDHRPAPRRRR
EAPRHRGHVPQRHHPGPPLPLPPLPDGLLAVGEPLPPPGARQGHQRRPRHLHQRLQRRSE
IRRQQRGGGGGDRGDDVQLHQGGGVGARDDVRAAAGGDAGDDPGGAAGEQRPAAPPRPPR
LLRPQDDPVRRRAGAAALRVGGVRHLQETVSPVTKRFSLFPPRIRFYRALNLSAFIHLPA
SEIL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggctgcaactgcctcgtcggcaagggcggcaacacgaggccagccgccacgacgagc
gcgcggccgtcgtcgtcgcggtgcgcgcactgcggcgcgggcctcgccgtgccgcggccg
gggccggggggcgctgccgccgtcaccaccgtccggtgcgcgctctgccaccgcatgacg
tgcgtcgaccggcgcggcggccgcgacctgggcggcggcggcggtggcggcgcgctcgag
gcctcgtcgtcgtcgtgggcgccggcggaggcgtcgttcctcaggcgagacgcgccgtcc
ggctacccgttcgtccccgggaggaagcgcgcgctcctcgtcggcgtcagctacaagggc
tccagctacgagctcgaggggaccgtcaacgacgtcgactgcatgaggcgcctcctcggc
gagagcttcggtttccccgccgattccatcctcgtgctcaccgctgggcgagggcgaccc
gtcgaggtcgccgacgagggcgaacctgctggcggcgatgcggtggctggtggaagggtg
cgacgccggcgactcgctggtgttccacttctccggccacggcgtgcagaagctggacgt
gaacggcgacgaggtggacggctacaacgaggcgctctgccccgtggacttcgagcggag
cggcaagatcctcgacgacgagatcaacgagaccatcgtccggcccctcgtcgccggcgc
gaagctccacgccatcgtggacacgtgccacagcggcaccatcctggacctccccttcct
ctgccgcctctcccggacgggctactggcagtgggagaaccactgccgccgcccggagct
cgccaagggcaccagcggcggcctcgccatctccatcagcggctgcagcgacgatcagaa
atccgcagacagcagcgcggcggcggcggcggcgatcggggcgatgacgtacagcttcat
cagggcggtggagtcggagcccgggacgacgtacgggcggctgctggcggcgatgcgggc
gacgatccgggaggggcagcaggggagcagcgtccggcggctcctccccggccgcctcgg
ctccttcgtccgcaagatgatcccgtccggcggcgtgcaggagccgcagctttgcgcgtc
ggaggtgttcgacatctacaggaaaccgtttctcctgtgacaaagcggttttctcttttc
ccgccacggattcggttttaccgcgcgctgaacctctctgctttcattcatctgcctgcc
tctgaaattctctga

DBGET integrated database retrieval system