KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0393900-01
Entry
Os03t0393900-01   CDS       T02163                                 

Gene name
Os03g0393900
Definition
(RAP-DB) Similar to S.tuberosum patatin (Fragment).
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: Patatin DUF2678
Other DBs
RAP-DB: Os03t0393900-01
Position
chr03:join(15836691..15837055,15837148..15837328,15837415..15837579,15837687..15838274)
AA seq 432 aa
MAASYSCRRTCEACSTRAMAGCVVGEPASAPGQRVTLLAIDGGGIRGLIPGTILAFLEAR
LQELDGPDARLADYFDCIAGTSTGGLITAMLAAPGDHGRPLFAASDINRFYLDNGPLIFP
QKRCGMAAAMAALTRPRYNGKYLQGKIRKMLGETRVRDTLTNVVIPTFDVRLLQPTIFST
YDAKSMPLKNALLSDICISTSAAPTYLPAHCFQTTDDATGKVREFDLIDGGVAANNPTMV
AMTQITKKIMVKDKEELYPVKPSDCGKFLVLSVGTGSTSDQGMYTARQCSRWGIVRWLRN
KGMAPIIDIFMAASSDLVDIHAAVMFQSLHSDGDYLRIQDNTLHGDAATVDAATRDNMRA
LVGIGERMLAQRVSRVNVETGRYVEVPGAGSNADALRGFARQLSEERRARLGRRNACGGG
GEGEPSGVACKR
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggcggcgagctactcgtgccggcggacatgcgaggcgtgcagcacgagggcgatggcc
gggtgcgtggtgggcgagccggcgtcggcgccggggcagcgggtgacgttgctggcgatc
gacggcggcggcatcaggggcctcatcccgggcaccatcctcgccttcctcgaggccagg
ctgcaggagctggatggccccgacgcgcgcctcgccgattacttcgactgcatcgccggg
accagcaccggcggcctcatcaccgccatgctcgccgcgcccggcgaccacggccgcccg
ctcttcgccgccagcgacatcaaccgcttctacctcgacaacggcccactcatcttccca
caaaagaggtgcggcatggcggcggccatggcggcgctgacgaggccgaggtacaacggc
aagtacctgcaggggaagatcaggaagatgctgggcgagacgagggtgcgcgacacgctg
acgaacgtcgtcatccccacgttcgacgtcaggctgctccagccaaccatcttctccaca
tacgacgcgaagagcatgccgctcaagaacgcgctcctctccgacatctgcatcagcaca
tccgcggcgccgacctacctccccgcgcactgcttccagaccaccgacgacgccaccggc
aaggtccgcgagttcgacctcatcgacggcggcgtcgccgccaacaacccgacgatggtg
gccatgacgcagatcaccaagaagataatggtgaaggacaaggaggagctgtacccggta
aagccgtcggactgcggtaagttcctggtgctgtccgtgggcaccgggtcgacgtcggac
caggggatgtacacggcgaggcagtgctcgcggtgggggatcgtccggtggctgcgcaac
aaggggatggcgcccatcatcgacatcttcatggcggccagctccgacctcgtcgacatc
cacgccgccgtcatgttccagtcgctgcacagcgacggcgactacctccgcatccaggac
aacacgctccacggcgacgccgccacggtggacgccgccaccagggacaacatgcgggcg
ctcgtcgggatcggcgagcggatgctggcgcagcgggtgtcgagggtcaacgtcgagacc
ggcaggtacgtcgaggtgcccggcgccggcagcaacgccgacgcgctgaggggcttcgcc
aggcagctctccgaggagaggagggcgaggctaggtcggcgaaacgcctgcggcggcggc
ggcgaaggagagcccagcggcgtggcgtgcaagcgttag

DBGET integrated database retrieval system