KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0401300-01
Entry
Os03t0401300-01   CDS       T02163                                 

Gene name
Os03g0401300, RSUS1, SUCROSE_SYNTHASE_1
Definition
(RAP-DB) Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2).
  KO
K00695  sucrose synthase [EC:2.4.1.13]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Os03t0401300-01 (Os03g0401300)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dosa01003]
    Os03t0401300-01 (Os03g0401300)
Enzymes [BR:dosa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.13  sucrose synthase
     Os03t0401300-01 (Os03g0401300)
Glycosyltransferases [BR:dosa01003]
 Others
  Other glycosyltransferases
   Os03t0401300-01 (Os03g0401300)
SSDB
Motif
Pfam: Sucrose_synth Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2
Other DBs
RAP-DB: Os03t0401300-01
Oryzabase: 2198
Position
chr03:complement(join(16305948..16306057,16305090..16305219,16304843..16304994,16304530..16304722,16304286..16304404,16303950..16304166,16303770..16303865,16303515..16303688,16303311..16303427,16303061..16303227,16302732..16302956,16302327..16302645,16301984..16302228,16301703..16301889))
AA seq 816 aa
MGEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKGMLQAHQIIAEYNNAIS
EADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEYVRVNVSELAVELLTVPEY
LQFKEQLVEEGTNNNFVLELDFEPFNASFPRPSLSKSIGNGVQFLNRHLSSKLFHDKESM
YPLLNFLRAHNYKGMTMMLNDRIRSLSALQGALRKAEEHLSGLSADTPYSEFHHRFQELG
LEKGWGDCAKRSQETIHLLLDLLEAPDPSTLEKFLGTIPMVFNVVIMSPHGYFAQANVLG
YPDTGGQVVYILDQVRAMENEMLLRIKQQGLNITPRILIVTRLLPDATGTTCGQRLEKVL
GTEHTHILRVPFRTENGIVRKWISRFEVWPYLETFTDDVAHEIAGELQANPDLIIGNYSD
GNLVACLLAHKMGVTHCTIAHALEKTKYPNSDLYWKKFEDHYHFSCQFTTDLIAMNHADF
IITSTFQEIAGNKDTVGQYESHMAFTMPGLYRVVHGIDVFDPKFNIVSPGADMSIYFPYS
ESRKRLTSLHPEIEELLYSEVDNNEHKFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRN
PRLQELVNLVVVCGDHGNPSKDKEEQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGEL
YRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQG
DKASALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSN
LERRETRRYLEMLYALKYRTMASTVPLAVEGEPSNK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgggggaagctgccggcgaccgcgtcctgagccgcctccacagcgtcagggagcgcatc
ggcgactccctctccgcccaccccaatgagctcgtcgccgtcttcaccaggctggttaac
ctcggaaagggaatgcttcaggcccaccagatcattgctgagtacaacaacgcaatctct
gaggctgatcgtgagaagctgaaggacggtgcttttgaggatgtcctgaggagtgcacag
gaggggattgttatctccccatgggttgcccttgccatccgcccgaggcccggtgtctgg
gagtatgtgagggtcaatgtgagcgagctcgctgttgagttgctgacagtccccgagtac
ttgcagttcaaggaacagcttgtggaagaaggcaccaacaacaactttgtgcttgagctg
gatttcgagccattcaatgcctccttccctcgtccttctctgtcgaagtccattggcaat
ggtgtgcagttcctcaacaggcatctgtcatcgaagctcttccatgacaaggagagcatg
tacccactgctcaacttccttcgtgcacacaactacaagggcatgaccatgatgttgaat
gacagaatccgcagtctcagtgctctccaaggtgctctgaggaaggctgaggagcatctt
tctggtctttcagcagacaccccttactcagaattccaccacaggttccaggaacttggt
ctggagaagggttggggtgactgtgccaagcgttcccaggagaccattcacctccttttg
gaccttcttgaggcccctgatccgtccaccctcgagaagttccttggaacaatcccaatg
gtgttcaatgttgtcattatgtccccacacggttacttcgcgcaagccaatgtcttgggt
taccctgacactggagggcaggttgtctacattttggaccaagtccgtgctatggagaat
gagatgcttctgaggatcaagcagcaaggtctcaatattacaccacgcatccttattgtc
accaggttgctccctgatgcaactggcaccacctgcggtcagcgtcttgagaaggtcctt
ggcaccgagcacacccacatcctacgtgtgcctttcagaactgaaaatggaattgttcgc
aagtggatctcacgttttgaagtctggccgtacctggaaacattcactgatgatgtcgcg
cacgaaattgctggagagctccaggccaatcctgacttgatcatcggaaactacagtgac
ggaaaccttgttgcatgcttgcttgcacacaagatgggtgttacccattgtaccattgcc
catgcgcttgagaaaaccaagtaccccaactctgacctctactggaagaagtttgaggat
cactaccacttctcatgccagttcacaactgacttgattgcgatgaaccacgctgacttc
atcatcaccagtaccttccaagagattgccggaaacaaggacactgttggtcagtatgag
tctcacatggcattcaccatgcctggtctgtaccgtgttgtccacggtattgatgttttt
gacccgaagtttaacattgtctcgcctggtgcggacatgtccatctacttcccttactct
gagtctcgtaagaggctcacctccctccacccagagattgaggagttgctctacagcgaa
gttgacaacaacgagcacaagtttatgctgaaggacaggaacaagccaatcatcttctcc
atggctcgtcttgaccgtgtcaagaacttgactggtctggttgagctgtatggtcgcaac
cctcgcctgcaagagctggttaaccttgtggttgtctgtggtgaccatggcaacccatct
aaggacaaggaggagcaggctgagttcaagaagatgtttgaccttattgagcaatacaac
ttgaatggccacatccgctggatctccgcgcagatgaaccgtgtccgcaacggtgagctc
taccgttacatctgcgacaccaagggtgcttttgtgcagcccgctttctacgaggcattc
ggtctcactgttgttgagtccatgacctgtggtctcccgacattcgcaaccgcctatggt
ggtccagctgagatcatcgtgaacggagtgtctggcttccacattgacccataccagggt
gacaaggcctcggcgctgctcgttgagttctttgagaagtgccaggaagaccccagccac
tggaccaagatctcgcagggcggtcttcagcgtatcgaggagaaatacacctggaagctc
tactctgagaggctgatgaccctcaccggcgtctacggattctggaagtacgtctcgaac
ctggagaggcgtgaaacccgccgctaccttgagatgctgtatgccctcaagtaccgcacc
atggctagcaccgtcccgttggccgtcgagggcgagccgtcgaacaagtga

DBGET integrated database retrieval system