KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0411100-01
Entry
Os03t0411100-01   CDS       T02163                                 

Gene name
Os03g0411100
Definition
(RAP-DB) Similar to Nuclear Y/CCAAT-box binding factor A subunit NF-YA.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os03t0411100-01 (Os03g0411100)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os03t0411100-01 (Os03g0411100)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os03t0411100-01
Position
chr03:join(16966930..16966992,16967081..16967234,16968868..16968998,16969076..16969150,16969431..16969598,16969953..16970315)
AA seq 317 aa
MIMLLQEMENHPVQCMAKTNYDFLARNNYPMKQLVQRNSDGDSSPTKSGESHQEASAVSD
SSLNGQHTSPQSVFVPSDINNNDSCGERDHGTKSVLSLGNTEAAFPPSKFDYNQPFACVS
YPYGTDPYYGGVLTGYTSHAFVHPQITGAANSRMPLPVDPSVEEPIFVNAKQYNAILRRR
QTRAKLEAQNKAVKGRKPYLHESRHHHAMKRARGSGGRFLTKKELLEQQQQQQQQKPPPA
SAQSPTGRARTSGGAVVLGKNLCPENSTSCSPSTPTGSEISSISFGGGMLAHQEHISFAS
ADRHPTMNQNHRVPVMR
NT seq 954 nt   +upstreamnt  +downstreamnt
atgataatgctgttgcaagaaatggagaatcatcctgtccaatgcatggccaagaccaac
tatgattttcttgccaggaataactatccaatgaaacagttagttcagaggaactctgat
ggtgactcgtcaccaacaaagtctggggagtctcaccaagaagcatctgcagtaagtgac
agcagtctcaacggacaacacacctcaccacaatcagtgtttgtcccctcagatattaac
aacaatgatagttgtggggagcgggaccatggcactaagtcggtattgtctttggggaac
acagaagctgcctttcctccttcaaagttcgattacaaccagccttttgcatgtgtttct
tatccatatggtactgatccatattatggtggagtattaacaggatacacttcacatgca
tttgttcatcctcaaattactggtgctgcaaactctaggatgccattgcctgttgatcct
tctgtagaagagcccatatttgtcaatgcaaagcaatacaatgcgatccttagaagaagg
caaacgcgtgcaaaattggaggcccaaaataaggcggtgaaaggtcggaagccttacctc
catgaatctcgacatcatcatgctatgaagcgagcccgtggatcaggtggtcggttcctt
accaaaaaggagctgctggaacagcagcagcagcagcagcagcagaagccaccaccggca
tcagctcagtctccaacaggtagagccagaacgagcggcggtgccgttgtccttggcaag
aacctgtgcccagagaacagcacatcctgctcgccatcgacaccgacaggctccgagatc
tccagcatctcatttgggggcggcatgctggctcaccaagagcacatcagcttcgcatcc
gctgatcgccaccccacaatgaaccagaaccaccgtgtccccgtcatgaggtga

DBGET integrated database retrieval system