KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0413000-01
Entry
Os03t0413000-01   CDS       T02163                                 

Gene name
Os03g0413000, HAP3I, HAP3_SUBUNIT_OF_CCAAT-BOX_BINDING_COMPLEX
Definition
(RAP-DB) Similar to Potential histone-like transcription factor.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os03t0413000-01 (Os03g0413000)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os03t0413000-01 (Os03g0413000)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP DUF747
Other DBs
RAP-DB: Os03t0413000-01
Oryzabase: 8488
Position
chr03:17085388..17086047
AA seq 219 aa
MPDSDNDSGGPSNYAGGELSSPREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECV
SEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGERAA
ASTTGAGTSAASTTPPQQQHTANAAGGYAGYAAPGAGPGGMMMMMGQPMYGSPPPPPQQQ
QQQHHHMAMGGRGGFGHHPGGGGGGSSSSSGHGRQNRGA
NT seq 660 nt   +upstreamnt  +downstreamnt
atgccggactcggacaacgactccggcgggccgagcaactacgcgggaggggagctgtcg
tcgccgcgggagcaggacaggttcctgccgatcgcgaacgtgagcaggatcatgaagaag
gcgctgccggcgaacgccaagatcagcaaggacgccaaggagacggtgcaggagtgcgtc
tccgagttcatctccttcatcaccggcgaggcctccgacaagtgccagcgcgagaagcgc
aagaccatcaacggcgacgacctgctctgggccatgaccaccctcggcttcgaggactac
gtcgaccccctcaagcactacctccacaagttccgcgagatcgagggcgagcgcgccgcc
gcctccaccaccggcgccggcaccagcgccgcctccaccacgccgccgcagcagcagcac
accgccaatgccgccggcggctacgccgggtacgccgccccgggagccggccccggcggc
atgatgatgatgatggggcagcccatgtacggctcgccgccaccgccgccacagcagcag
cagcagcaacaccaccacatggcaatgggaggaagaggcggcttcggtcatcatcccggc
ggcggcggcggcgggtcgtcgtcgtcgtcggggcacggtcggcaaaacaggggcgcttga

DBGET integrated database retrieval system