KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0424800-00
Entry
Os03t0424800-00   CDS       T02163                                 

Gene name
Os03g0424800
Definition
(RAP-DB) Similar to 40S ribosomal protein S19-3.
  KO
K02966  small subunit ribosomal protein S19e
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Os03t0424800-00 (Os03g0424800)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dosa03011]
    Os03t0424800-00 (Os03g0424800)
Ribosome [BR:dosa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    Os03t0424800-00 (Os03g0424800)
  Archaea
    Os03t0424800-00 (Os03g0424800)
SSDB
Motif
Pfam: Ribosomal_S19e
Other DBs
RAP-DB: Os03t0424800-00
Position
chr03:join(17727098..17727187,17727996..17728086,17728232..17728415,17728500..17728575)
AA seq 146 aa
MADSTARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRA
ASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDP
KGGRLITSQGRRDLDQVAGRVDVTIA
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcggattcgacggcgaggacggtgaaggacgtgaaccctcatgagttcgtcaaggcc
tactccgcccacctcaagcgctccggcaagatggagctccctgagtgggttgacatcgtg
aagactgcgaggttcaaggagctccctccttatgatccggactggtactacacgagggct
gcctcgattgcaaggaagatctacctgaggcagggtattggtgtaggtggcttccagaag
atctatggtggccgccagaggaacggctcacgccccccgcacttctgcaagagcagcggc
gctatctcacgcaacatccttcagcagctgcagaagatgggcatcattgatgtcgacccg
aagggtggaagactcatcacctcccagggaaggcgtgatctggaccaagtggccggaaga
gttgatgttaccatcgcctga

DBGET integrated database retrieval system