KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0647600-01
Entry
Os03t0647600-01   CDS       T02163                                 

Gene name
Os03g0647600
Definition
(RAP-DB) Similar to Nf-Y-A subunit.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os03t0647600-01 (Os03g0647600)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os03t0647600-01 (Os03g0647600)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os03t0647600-01
Position
chr03:complement(join(25073379..25073667,25071539..25071657,25071301..25071369,25070759..25070902,25069604..25070047))
AA seq 354 aa
MLSFKQSHEGFGHVAAAGAGPQQQQQPWWAGSQLLYGEASPEEAALRDGGQFQVVPGGRA
ALDPAAPEPEKTAVPAMPKRGGGGGAPEVLKFSVFSGNLEPGDTGEKNREHSATIAMQSP
LPEYNGHFELGLGQSMVSPNYPCIDQCYGLMTTYAMKSMSGGRMLLPLNAPADAPIYVNA
KQYEGILRRRRARAKAQRENRLVKGRKPYLHESRHRHAMRRARGSGGRFLNTKKEATAAG
CGGSSKTPLASLVSPADVAHRPGSGGRASSLSGSDVSSPGGVMYDHHRHDDADAADHYNS
IDHHLRTPFFTPLPIIMDSGGGGGDHASHSAAAVAAPFRWATAAGDGCCELLKA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgagcttcaagcagagccacgaggggttcggccatgtcgccgccgctggagctgga
ccgcagcagcagcagcagccgtggtgggcggggtcgcagctgctgtacggggaggcgtcg
ccggaggaggcggcgctgcgcgacggcggccagttccaggtcgtgcccggaggccgcgcc
gcgctggatccggcggcgccggagccggagaagacggcggtgccggcgatgcccaagaga
ggaggaggaggaggggctcctgaggtgctgaaattctcggtgttttcaggtaatttggag
ccgggagatacaggagagaagaacagagagcactctgccactattgcaatgcaatcgccg
ttgccagaatacaacggccatttcgagcttggtcttggtcaatccatggtctctcccaat
tatccttgtattgaccaatgctatggtcttatgaccacctacgcgatgaaatcaatgagt
ggcgggcgaatgctactgccgctgaacgcgccagccgatgcgccgatctatgtcaacgcg
aagcagtacgaaggcatcctccgccgtcgccgtgcccgcgccaaggcccagagggagaac
aggctggtcaaaggcaggaagccctacctccacgagtcgcgccaccgccacgccatgcgc
cgggccagaggctccggcggccgcttcctcaacaccaagaaagaagccaccgccgccgga
tgcggcggcagcagcaagacgcccctcgcgtccctcgtcagccccgccgacgtagcccat
cgtccaggctccggcggccgcgcgtccagcctctccggctccgacgtgtcgtcgccggga
ggcgtcatgtacgaccaccaccgccacgacgacgccgacgcggcggaccactacaacagc
atcgaccaccacctccgcacgccgttcttcaccccgctcccgatcatcatggacagcggc
ggcggcggcggcgaccacgcctcacactccgccgccgccgtcgccgcccccttcaggtgg
gcgacggcggccggcgacggctgctgcgagctcctcaaggcgtga

DBGET integrated database retrieval system