KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0651000-01Help
Entry
Os03t0651000-01   CDS       T02163                                 

Gene name
Os03g0651000
Definition
(RAP-DB) Glu-tRNAGln amidotransferase, C subunit family protein.
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00970  Aminoacyl-tRNA biosynthesis
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Os03t0651000-01 (Os03g0651000)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dosa03029]
    Os03t0651000-01 (Os03g0651000)
Enzymes [BR:dosa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Os03t0651000-01 (Os03g0651000)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Os03t0651000-01 (Os03g0651000)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Os03t0651000-01 (Os03g0651000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
RAP-DB: Os03t0651000-01
Position
chr03:join(25276525..25276758,25276866..25276906,25277300..25277355,25278095..25278149,25278230..25278305)
AA seq 153 aa AA seqDB search
MLSAAASAIPRLRWAAPPRNQSARNQWLLLRRRSLSSSPPYVTPGIPAAAAAAGSGALEP
PDLPRLANAARISLSPEEAEEFAPKIRQVVDWFGQLQAVDLESVEPSLRAGTAAGNSLRE
DRPETFTNRDAIIESVPSYDDPYIKVPRVLNKE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgccgccgcctcggccatcccgaggctccgctgggccgcgccgccgcggaac
cagtctgcgaggaaccaatggttgctgctgcggcggcgttccctctcctcctcacctccc
tacgtgacgcccggtatcccggcggcggcggcggcggcagggagtggggctctcgagccg
ccggacctgccccgcctcgccaacgcggcacgcatctctctctcgccggaagaggctgag
gagttcgcgccgaagattcggcaggtggtggattggtttgggcaacttcaagccgtcgat
cttgaatctgttgagccttcacttagagctggtactgcggcaggtaattcattgagagaa
gacaggcctgaaacatttactaacagagatgccataatagagtctgtcccaagctatgat
gatccatacatcaaggtgccaagagtgctgaacaaagaatga

DBGET integrated database retrieval system