KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0696300-01
Entry
Os03t0696300-01   CDS       T02163                                 

Gene name
Os03g0696300
Definition
(RAP-DB) Similar to Nuclear transcription factor Y subunit A-1.
  KO
K08064  nuclear transcription factor Y, alpha
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os03t0696300-01 (Os03g0696300)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os03t0696300-01 (Os03g0696300)
SSDB
Motif
Pfam: CBFB_NFYA
Other DBs
RAP-DB: Os03t0696300-01
Position
chr03:join(27891481..27891724,27892412..27892515,27892636..27892707,27893267..27893440,27893639..27893762,27893847..27893911)
AA seq 260 aa
ASMESRPGGTNLVEPRGQGALPSGIPIQQPWWTTSAGVGAVSPAVVAPGSGAGISLSGRD
GGGDDAAEESSDDSRRSGETKDGSTDQEKHHATSQMTALASDYLTPFSQLELNQPIASAA
YQYPDSYYMGMVGPYGPQAMSAQTHFQLPGLTHSRMPLPLEISEEPVYVNAKQYHGILRR
RQSRAKAELEKKVVKSRKPYLHESRHQHAMRRARGTGGRFLNTKKNEDGAPSEKAEPNKG
EQNSGYRRIPPDLQLLQKET
NT seq 783 nt   +upstreamnt  +downstreamnt
gcgagcatggagtcgaggccggggggaaccaacctcgtggagccgagggggcagggcgcg
ctgccgtccggcataccgatccagcagccgtggtggacgacctccgccggggtcggggcg
gtgtcgcccgccgtcgtggcgccggggagcggtgcggggatcagcctgtcgggcagggat
ggcggcggcgacgacgcggcagaggagagcagcgatgactcacgaagatcaggggagacc
aaagatggaagcactgatcaagaaaagcatcatgcaacatcgcagatgactgctttggca
tcagactatttaacaccattttcacagctggaactaaaccaaccaattgcttcggcagca
taccagtaccctgactcttactatatgggcatggttggtccctatggacctcaagctatg
tccgcacagactcatttccagctacctggattaactcactctcgtatgccgttgcctctt
gaaatatctgaggagcctgtttatgtaaatgctaagcaatatcatggaattttaagacgg
aggcagtcacgtgcgaaggctgaacttgagaaaaaagttgttaaatcaagaaagccctat
cttcatgagtctcgtcatcaacatgctatgcgaagggcaagaggaacgggtggacgcttc
ctgaacacaaagaaaaatgaagatggtgctcccagtgagaaagccgaaccaaacaaagga
gagcagaactccgggtatcgccggatccctcctgacttacagctcctacagaaggaaaca
tga

DBGET integrated database retrieval system