KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0727600-01
Entry
Os03t0727600-01   CDS       T02163                                 

Symbol
Os03g0727600, ACC_SYNTHASE_1, ACS1
Name
(RAP-DB) 1-aminocyclopropane-1-carboxylate synthase 1 (EC 4.4.1.14) (ACC synthase 1) (S-adenosyl-L-methionine methylthioadenosine-lyase 1).
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00270  Cysteine and methionine metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Os03t0727600-01 (Os03g0727600)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dosa01007]
    Os03t0727600-01 (Os03g0727600)
Enzymes [BR:dosa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     Os03t0727600-01 (Os03g0727600)
Amino acid related enzymes [BR:dosa01007]
 Aminotransferase (transaminase)
  Class I
   Os03t0727600-01 (Os03g0727600)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
RAP-DB: Os03t0727600-01
Oryzabase: 518
Position
chr03:complement(join(29662585..29662761,29662352..29662489,29662093..29662253,29661007..29661994))
AA seq 487 aa
MVSQVVAEEKPQLLSKKAGCNSHGQDSSYFLGWQEYEKNPFDPVSNPSGIIQMGLAENQL
SFDLLEEWLEKNPHALGLRREGGGASVFRELALFQDYHGLPAFKNALARFMSEQRGYKVV
FDPSNIVLTAGATSANEALMFCLADHGDAFLIPTPYYPGFDRDLKWRTGAEIVPVHCASA
NGFRVTRPALDDAYRRAQKRRLRVKGVLITNPSNPLGTASPRADLETIVDFVAAKGIHLI
SDEIYAGTAFAEPPAGFVSALEVVAGRDGGGADVSDRVHVVYSLSKDLGLPGFRVGAIYS
ANAAVVSAATKMSSFGLVSSQTQYLLAALLGDRDFTRSYVAENKRRIKERHDQLVDGLRE
IGIGCLPSNAGLFCWVDMSHLMRSRSFAGEMELWKKVVFEVGLNISPGSSCHCREPGWFR
VCFANMSAKTLDVAMQRLRSFVDSATGGGDNAALRRAAVPVRSVSCPLAIKWALRLTPSI
ADRKAER
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggtgagccaagtggtcgccgaggagaagccgcagctgctgtccaagaaggccgggtgc
aacagccacggccaggactcgtcctacttcctggggtggcaggagtacgagaaaaacccg
ttcgaccccgtctccaacccttccggcatcatccagatgggcctcgccgagaaccagctg
tcgttcgacctgcttgaggagtggctggagaagaacccccacgcgctcggcctccggcga
gagggcggcggcgcctccgtcttccgcgagctcgcgctgttccaggactaccacggcctc
ccggctttcaaaaatgcattggcgcggttcatgtcggagcagagagggtacaaggtggtg
ttcgaccccagcaacatcgtgctcaccgccggcgccacctcggctaacgaggcgctcatg
ttctgcctcgccgaccacggcgacgccttcctcatccccaccccatactacccagggttc
gaccgcgacctcaagtggcgcaccggcgcggagatcgtacccgtgcactgcgcgagcgcg
aacgggttccgggtgacgcgccccgcgctggacgacgcgtaccgccgcgcgcagaagcgc
cggctgcgcgtcaagggggtgctgatcaccaacccgtccaacccgctcggcaccgcgtcg
ccgcgcgccgacctcgagacgatcgtcgacttcgtcgccgccaagggcatccacctcatc
agcgacgagatctacgccggcacggcgttcgccgagccgcccgcgggcttcgtcagcgcg
ctcgaggtcgtggccgggcgcgacggcggcggcgctgacgtgtccgaccgcgtgcacgtc
gtgtacagcctgtccaaggacctcggcctcccggggttccgcgtcggcgccatctactcc
gccaacgccgccgtcgtgtccgcggcgaccaagatgtccagcttcggcctcgtgtcgtcc
cagacgcagtacctcctcgcggcgctgctcggcgacagggacttcacccggagctacgtc
gcggagaacaagcggcggatcaaggagcggcacgaccagctcgtggacgggctcagggag
atcggcattgggtgcctgcccagcaacgccggcctcttctgctgggtggacatgagccac
ctgatgcggagccggtcgttcgccggcgagatggagctctggaagaaggtggtgttcgag
gtcggcctcaacatctcccccgggtcgtcgtgccactgccgcgagcccggctggttccgc
gtctgcttcgccaacatgtcggccaagaccctcgacgtcgccatgcagcgcctcaggtcg
ttcgtcgactccgccaccggcggcggcgacaacgccgccctccgccgcgccgccgtcccc
gtcaggagcgtcagctgcccgctcgccatcaagtgggcgctccgcctcaccccgtccatc
gccgaccggaaggccgagagataa

DBGET integrated database retrieval system