KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0754900-01
Entry
Os03t0754900-01   CDS       T02163                                 

Gene name
Os03g0754900
Definition
(RAP-DB) Similar to Cleavage stimulation factor, 50 kDa subunit.
  KO
K14406  cleavage stimulation factor subunit 1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    Os03t0754900-01 (Os03g0754900)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dosa03019]
    Os03t0754900-01 (Os03g0754900)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage stimulation factor (CSTF) complex
     Os03t0754900-01 (Os03g0754900)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Position
chr03:join(31134596..31134787,31134913..31135031,31135141..31135210,31135477..31135560,31135657..31135743,31135830..31135900,31136047..31136098,31136206..31136304)
AA seq 257 aa
MDAAVQEAKLLRQVNALIVAHLRDHNLTQAAAAVAAATMTPLAPPEPDGDDSVPANQLLR
LVAKGLAVEREETGRGGGAFDSAAAAAGYGGLLPPLGTNAVDFSTQDVKGSSKSFPKHEA
RHVSDHKNVVRCAKFSPDGKYFASGSGDTSIKFFEVAKIKQMMLGDSKDGPVRPVIRTFY
DHTQPINDLDFHPESPILISAAKDNTIRFFDFSKTVARKAFRVIQDTHNVRSVCFHPCGD
YLLAGSTIILSPYGFYL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggacgcggcggtgcaggaggcgaagctgctgcgccaggtgaacgccctcatcgtggcg
cacctccgcgaccacaacctcacgcaggctgccgccgccgtcgccgccgccaccatgacg
cccctcgccccgcccgagcccgacggcgacgactccgtccccgccaaccagctcctccgc
ctcgtcgccaagggcctcgcggtggagcgggaggagacggggaggggaggaggggcgttc
gactctgccgccgccgccgctggatacggtggattgttgccgccgctcggcaccaatgcc
gtggatttcagcacgcaggatgttaagggctcatccaagagcttccccaagcacgaggcc
aggcacgtatctgatcacaagaatgttgtccgatgtgcaaaatttagtcctgatgggaaa
tattttgcatccgggagtggtgacacatcaattaagttcttcgaggttgctaaaataaag
cagatgatgctaggggattccaaagatggccctgtccgtcctgtgatccgtactttttac
gatcacacgcagcccatcaatgatcttgattttcatcctgagagccccatactgatatct
gcagcaaaagacaatacaataaggttcttcgacttctcaaaaactgttgcaaggaaagca
ttcagagttattcaggacactcacaatgttagatccgtatgttttcatccttgtggggat
taccttttagcaggtagtactattatcctttcaccatatggattttacctgtaa

DBGET integrated database retrieval system