KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0771500-01
Entry
Os03t0771500-01   CDS       T02163                                 

Gene name
Os03g0771500, OSH43, HOMEOBOX_43
Definition
(RAP-DB) Similar to Isoform 2 of Homeobox protein knotted-1-like 8.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: KNOX1 KNOX2 Homeobox_KN ELK Homeodomain
Other DBs
RAP-DB: Os03t0771500-01
Oryzabase: 2979
Position
chr03:join(31964878..31965192,31965326..31965463,31965590..31965698,31969455..31969651,31969754..31970005)
AA seq 336 aa
MESFASLAGGGSSSTTARLPELISPENPDHISPPPLLYQLLAGPESSARQHGHDGHHHGG
GGGEAAAAAVQGQVSPAGAEAAVKAEIMSHPQYSALLAAYLGCKKVGAPPDVLTKLTAVP
AAQQLDEADGHPRRRHEPQRDDDPDQLDQFMDAYCSMLTRYREELERPILEAAEFFSRVE
TQLDSLAGTGSSEEEQDPSDKQLKHQLLRKYGGSLGDLRQVFSKRTKKGKLPKEARQKLL
HWWELHYKWPYPSEMEKMTLAQTTGLDQKQINNWFINQRKRHWKPTPVAGTAFPTMEAAG
GGFRHSGHGGGLAAAAALPLYMGRPFVVDGMYRLGS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggagagcttcgccagtctcgcaggaggtggcagcagcagcaccacagctcggttgccg
gagctgatctcgccggagaacccggaccacatctcgccgcccccgttgctgtaccagctg
ctcgccggcccggagtcgtcggcgcggcagcatgggcatgatgggcatcaccacggcggc
ggtggcggcgaagcagcagcagcagctgtgcagggacaggtctcgccggcaggcgcggag
gcggcggtcaaggccgagatcatgtcgcatccacagtactcggctctcctagccgcctac
ttaggctgcaaaaaggtcggggcgccgccggatgtactgaccaagctcacggctgtgccg
gcggcgcagcagctggacgaagccgacggccaccctcgtcgccggcacgagccacagcgt
gatgacgacccggatcagctcgatcagttcatggacgcgtactgcagcatgctgacgagg
tacagggaggagctggagcggccgatcctggaagccgcggagttcttcagcagggtggag
acgcagctcgattcgctcgctggcacgggatcatcagaggaagagcaagaccctagtgac
aagcagctgaagcaccagcttctgaggaagtacggtggctcgttgggcgatctccggcag
gtgttctccaagaggaccaagaaagggaagcttcccaaggaggccaggcagaagcttctg
cactggtgggagctgcactacaagtggccctatccctccgagatggagaagatgacgctg
gcgcagacgacggggctggaccagaagcagatcaacaactggttcatcaaccagaggaag
cggcactggaagccgacgccggtggcaggcacggccttcccgacgatggaagctgccgga
ggcggcttccgacactccggccacggcggcggccttgcggcggcggcggcgctgccgctg
tacatgggcaggccgttcgttgtggacggcatgtaccggctcgggtcttga

DBGET integrated database retrieval system