KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0818100-01Help
Entry
Os03t0818100-01   CDS       T02163                                 

Gene name
Os03g0818100
Definition
(RAP-DB) Histidine acid phosphatase family protein.
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa00562  Inositol phosphate metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os03t0818100-01 (Os03g0818100)
   00562 Inositol phosphate metabolism
    Os03t0818100-01 (Os03g0818100)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Os03t0818100-01 (Os03g0818100)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Os03t0818100-01 (Os03g0818100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
RAP-DB: Os03t0818100-01
Position
chr03:join(34334835..34334974,34335142..34335226,34335543..34335842,34336608..34336766,34337266..34337406,34337492..34337548,34337948..34338086,34338368..34338472,34338573..34338790,34339394..34339435,34339550..34339723)
AA seq 519 aa AA seqDB search
MAAPRTPLPLVLLLVSAALLAAAPLSPAAETGAAAFDVRRHLSTVTRYDVARGSNSVSSA
PSMSDECRVIHLNLVARHGTRAPTKKRIKELDRLAVRLKALIDEAKQGPESDSLKKIPSW
MKGWESPWKGRVKGGELVSEGEEELYNLAIRVKERFQGLFDEEYHPDVYSIRATQVPRAS
ASAVAFGLGLLSGKGKLGPVKNRAFSVLSESRASDICLRFFDSCETYKDYRKRKEPDVEK
QKEPILEHVTSALVNRYHLNFTPKDVSSLWFLCKQEASLMNITNQACQLFNEAEVYFLEW
TDDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIVAKEENHPDGTYEKARLRFAHAET
VVPFSCLLGLFLEGSDFAKIQREESLDIPPVPPQGRNWKGSVVAPFAGNNMLALYQCPGK
TDGGKISRDQKSSYFVQVIHNEAPVSMPGCGNKDFCPFEEFKEKIVEPHLKHDYDALCKI
RPVAREEPSSFSSRMSNFFLGLFSQKGYRVSAQDVKSEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccccgcacgcctctccccctcgtcctcctcctcgtctccgccgcgctcctc
gcggcggctcccctctcgccggcggccgagaccggtgccgccgcgttcgacgtccgccgc
cacctctccaccgtcaccaggtacgatgtggcgaggggatccaatagtgtgtcctccgcg
ccgtctatgtcggatgagtgccgcgtgatccacctcaatctcgtggcaagacatgggact
cgcgcacctaccaaaaagagaatcaaagagctggatagactggcggttcggttgaaggct
cttatcgatgaagcaaaacaagggcctgaaagtgactccctgaaaaaaattccttcatgg
atgaaagggtgggagtcaccctggaaaggtagggtgaaaggtggtgagctggtcagtgaa
ggggaggaagagctatacaaccttgctatcagagtcaaggagaggtttcaaggcctattt
gatgaggaatatcaccctgatgtgtattcaataagagcaactcaggttcctcgggcatca
gctagtgcagtagcatttggtttgggtctactttctgggaaagggaagcttggacctgtg
aaaaaccgtgccttttctgttctgagtgagagtcgtgcaagtgatatttgtctgcgattc
tttgatagctgtgaaacatacaaggactacaggaaaagaaaggagcctgatgttgaaaag
caaaaggaaccaattttagaacacgtcacatcggcattagttaaccgttatcatctcaat
tttacaccaaaagatgtttcttccctctggttcctttgcaagcaggaagcatctttaatg
aatataaccaatcaagcttgtcaactttttaatgaagctgaggtttattttctagagtgg
acagatgatctggagggctttgtgctaaaaggttatggtgagtcaataaactatcggatg
ggactgccattgctcaaggacgttgtccagtcaatggaagaagcaatcgttgctaaagaa
gaaaaccaccctgatggtacatatgagaaggcaaggctccgatttgcacatgctgaaact
gttgtccctttctcatgtcttcttggtctttttcttgaaggatcagattttgcgaagata
caacgggaggaatcattggacatacctcctgtgccaccacagggaagaaattggaagggc
agtgttgttgcaccttttgctggtaacaatatgttggctttgtaccagtgcccaggaaaa
actgatggtggtaagatttctcgggatcagaagagctcatacttcgtgcaggttatacac
aatgaagctccagtttcaatgccgggatgcgggaacaaagatttctgcccatttgaagag
ttcaaggagaagatagttgaaccccacctgaagcatgactacgacgccctatgcaagata
aggccggtggcaagagaggagccttcctccttcagttccaggatgtccaatttcttccta
ggtttgttctcgcagaaaggataccgtgttagtgctcaggatgtgaagtcggagctgtag

DBGET integrated database retrieval system