KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os03t0825700-01
Entry
Os03t0825700-01   CDS       T02163                                 

Gene name
Os03g0825700
Definition
(RAP-DB) Similar to Defective in exine formation.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: VCBS FG-GAP BBS2_Mid PQQ_2
Other DBs
RAP-DB: Os03t0825700-01
Position
chr03:join(34680157..34680293,34681892..34682002,34682411..34682493,34682701..34682818,34682917..34683128,34683581..34684065,34684145..34684215,34684607..34684863,34685234..34685411,34685763..34686050,34686139..34686256,34686988..34687170,34687262..34687576)
AA seq 851 aa
MRPLLAFAAVCALLVAAAAPAAAEEEKANKFRQREATDDMLGYPHLDEDALLKTKCPKHV
ELRWQTEVSSSIYATPLIADINSDGKLEVVVPSFVHYLEVLEGSDGDKLPGWPAFHQSNV
HSSPLLYDIDKDGTREIVLATYNGVVNFFRVSGYMMMDKLEVPRRKVHKDWYVGLNTDPV
DRSHPDVHDSSIAKKAASEESHPNIQDKPVVNESSKESQSRSTNDSTTRGVDSMKHASKE
EPVESKPNSTRGQENMDVLNNLNSTDAGNNSSLSTTTENASHVQRRLLQTDEKSNQAGSS
ETDASDTGTAKAATVENSEPLEADADASFNLFRDVEDLPDEYNYDYDDYVDETMWGDEDW
KEQQHEKAEDYVSIDAHILSTPVIADIDRDGIQEMVISVSYFFDHEYYDKPEHLKELGGI
DIGKYIASSIVVFNLDTRQVKWTAELDLSTDSGNFTAHAYSSPTVVDLDGDGNLDILVGT
SFGLFYVIDHRGKVRNKFPLEMAEIHAPVIAADINDDGKIEMVTADVHGNVAAWTAEGEE
IWEVHLKSLIPQRPTVGDVNGDGRTEVVVPTVSGNIYVLSGKDGSKIQPFPYRTHGRIMS
PVLLLDMSKHDEKSKGLTLATTSFDGYLYLIEGSSGCADVVDIGETSYSMVLADNVDGGD
DLDLIVTTMNGNVFCFSTPSPHHPLKEWRSSNQGRNNAAYRYNREGIYVKHGSRTFRDEE
GKHFWVEFEIVDKYRVPYGNQAPYNVTVTLLVPGNYQGERRIVVNAAYNEPGKQRMKLPT
VPVRTTGTVLVEMVDKNGFYFSDEFSLTFHMHYYKLLKWLVLLPMLGMFSVLVILRPQEG
APLPSFSRNID
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgcgtcccctcctcgccttcgcggcggtatgcgcccttctcgtggctgccgcagcgccg
gcggccgcggaggaggagaaggcgaacaagttccggcagcgcgaggccaccgacgacatg
cttggatacccccaccttgatgaagatgctttattgaagaccaagtgtccaaaacatgta
gagctgagatggcagactgaagttagttccagcatttatgcaactccgttgatcgctgat
atcaacagcgatggaaagttggaagtagtggtgccatcatttgttcattacctggaagtt
cttgaaggctctgatggggacaaattgccaggatggcctgcatttcaccagtcaaatgtt
cattcaagtccacttctatatgatattgacaaggacgggacacgggaaatagttttggca
acttacaatggtgtagtgaatttcttcagggtatcaggttatatgatgatggacaagcta
gaagtacctcgtaggaaggtacacaaagactggtatgttgggctgaatacagatcccgtt
gaccgctcccatccagatgttcatgacagctcaattgcaaagaaagctgcttctgaagaa
tctcacccaaatattcaggacaagccagttgtgaatgaatcttctaaggaatcccagtca
cggagcacaaatgactcaacaacacgaggagttgattccatgaaacatgcgtctaaggaa
gagccagttgaaagtaaacctaattctacccgaggacaggagaatatggatgtgttaaac
aatctaaacagcacagatgctgggaacaactctagtttaagtactacaacagagaatgca
tcacatgttcagagaaggttgcttcaaacagatgagaaaagtaatcaagcaggaagctca
gaaactgatgcaagtgataccggaacagcaaaagcagctactgttgaaaatagcgagcct
ctagaggctgatgctgatgcatcatttaatttgtttcgggatgtagaagatctgcctgat
gagtacaattacgattatgatgactacgttgatgaaaccatgtggggagacgaggactgg
aaagaacaacaacatgaaaaggcagaagattatgtgagcatagatgctcacatcttgtcc
accccagtgattgcagatattgacagagatggcatacaagaaatggtgatttctgtatct
tacttctttgaccacgagtattatgataaaccagaacatctaaaggagttaggagggatt
gacattggcaaatatattgcaagcagtatagttgtttttaaccttgacacaagacaagtc
aaatggactgcagaacttgatttgagtacagatagtggaaattttactgcccatgcatat
tcttcgccgaccgtggttgatttggatggtgatggaaatttggatattcttgttggaact
tcctttggcttgttttatgttatcgatcatcgtggtaaggttaggaacaagttcccactt
gagatggcggagattcatgcaccagtcattgcagcagatatcaatgatgatgggaaaatc
gagatggtcactgctgatgtccatggcaatgtagcagcatggactgcagagggagaagaa
atctgggaggttcatcttaagagtcttatcccacagcgccctactgttggtgatgttaat
ggagatggtcgcactgaagttgtggtcccaaccgtgtcaggaaacatatatgttcttagt
ggaaaggatggctcaaaaattcagcctttcccatatagaacgcatggaaggatcatgagt
cctgttctattgcttgacatgagcaaacatgatgaaaagtctaaaggcctcacccttgct
actacatcctttgatggttacttgtatttgattgagggctcaagtggctgtgcagatgtt
gttgacattggagagacctcgtacagtatggttttggctgataatgttgatggtggagat
gacctcgatcttattgttactaccatgaatggcaatgtcttctgcttctccactccctct
ccgcaccatccacttaaggaatggagatcatcaaaccagggaagaaacaatgctgcatat
cgttacaaccgtgaaggtatttatgttaaacacggttccagaacattccgtgacgaagag
ggcaagcatttctgggtagagtttgagattgtggacaagtacagggttccttatgggaac
caagctccttataacgtgacggttactctacttgtccctgggaattatcaaggagaaagg
cgcattgtggttaatgcagcttataatgaaccaggcaagcagcggatgaagcttcccaca
gttcctgtgagaaccacaggaactgtgcttgtggaaatggttgacaaaaacgggttctac
ttctctgacgagttctcgctcaccttccacatgcattattacaagcttctgaaatggctc
gtgcttcttccaatgcttgggatgtttagcgttcttgtcatcctgcggccacaagaaggc
gctccgttgccatcattttcaaggaatattgattag

DBGET integrated database retrieval system