KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0185000-00Help
Entry
Os04t0185000-00   CDS       T02163                                 

Gene name
Os04g0185000
Definition
(RAP-DB) Similar to OSIGBa0140C02.6 protein.
  KO
K01426  amidase [EC:3.5.1.4]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00330  Arginine and proline metabolism
dosa00360  Phenylalanine metabolism
dosa00380  Tryptophan metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Os04t0185000-00 (Os04g0185000)
   00360 Phenylalanine metabolism
    Os04t0185000-00 (Os04g0185000)
   00380 Tryptophan metabolism
    Os04t0185000-00 (Os04g0185000)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Os04t0185000-00 (Os04g0185000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
RAP-DB: Os04t0185000-00
Position
chr04:join(5781635..5781823,5782056..5782412)
AA seq 181 aa AA seqDB search
MVIENIGTTENQTEVKNHLFEIDLVAMKAEFKLSLNAYLSDLLYSPVRSLADVIAFNNAH
PVEERLKDFGQSFLTDSQKTNGIGPREKTVLKILKEISTDVLEKLMKKHQLDAIVTPNSD
ASTIFAIGGMPAIAVPAGYDNQGVPFAICFGGLKGYEPRLIEMAYAFEQATKVRRMPRYK
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagagaatatcggcaccacagaaaatcagactgaagtaaagaatcatcttttc
gaaattgatcttgtcgctatgaaagcagagttcaagttaagcttaaatgcttatttgtca
gacttgctgtactccccagttcgttctcttgcagatgtcatagcattcaacaatgcacat
cctgtggaggagaggcttaaagattttggacagagctttcttactgattcccaaaaaacc
aatggcattggacccagggagaaaactgtactcaagatactcaaagagatatctactgat
gtgttggagaaactgatgaagaagcaccagttggatgcgattgtcacacccaactctgac
gcctccaccattttcgccatcggcggcatgccggcgatcgctgtaccagctgggtatgac
aatcagggagtgccatttgctatctgcttcggtggattgaagggctacgagccgaggctt
atcgaaatggcctatgcttttgagcaagctaccaaagttcgaaggatgccacgttacaag
cactag

DBGET integrated database retrieval system