KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0446500-01Help
Entry
Os04t0446500-01   CDS       T02163                                 

Gene name
Os04g0446500
Definition
(RAP-DB) Similar to OSIGBa0140O07.15 protein.
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os04t0446500-01 (Os04g0446500)
Enzymes [BR:dosa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Os04t0446500-01 (Os04g0446500)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Os04t0446500-01 (Os04g0446500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPL
Motif
Position
chr04:join(22258476..22258491,22258604..22258677,22258819..22259042,22259171..22259319,22259410..22259493,22260129..22260426,22260506..22260712,22260813..22260852)
AA seq 364 aa AA seqDB search
MSSFWGAEVKPGKPYTHTHIPRLGRLRLTQATLGGEAGKVEKGGGGKKNVVQLQCTVKNK
DPVFLCALVPGQSETCHLELEFEEKHVTFSVLGPRSVHLAGYYIGDVYGEEIDDSDTGSD
SLQGSDDDAFLDTDDDDSGADDGTVLIPLSPGNSDGEDDDSEYDSEDDDSEMIYNQRRGK
SSVVIEEIQEDDKPAAGGAQKGSNKKQTSENGDDSKLQLVVRTPPAESLESEDEDGFPVS
FSESKKRTDGSSKKKGNLNNKMSTEDRKRKSSAVGDHHDPSGEVKDENDGVSKKNKKAKA
KKTAVGGVEKEIKQEDSPADLVDAKQKKNKNKNTSEAEAGAHQNTDKTKHIHTDAEEDTA
QEAS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgttttggggcgcggaggtgaagcccgggaagccctacacccacacccacatc
ccgcgcctcggccgcctgcgcctcacccaggcgacgcttggaggggaggctgggaaggtg
gagaagggcggcggtgggaagaagaacgtggtgcagttacagtgcactgtgaagaacaag
gatcccgtgttcctgtgtgccctggtgccggggcagtcggagacttgccacctggagctc
gagttcgaggagaagcacgtcacgttctcggtgctcgggccgaggagcgtccacctcgct
ggatactacattggtgatgtgtatggggaggagatagatgacagtgatactggtagtgac
tctctgcaaggctcagatgatgatgcttttctggatactgatgatgatgacagtggcgct
gatgatggcactgttctcatcccattatctcctggaaactcagatggtgaagatgatgat
tcagagtatgactcagaggatgatgactcagagatgatatacaatcagcgtagaggcaaa
agttcagttgttattgaggaaattcaagaggatgacaagcctgctgctggtggagcacaa
aagggatcaaacaagaagcaaaccagcgaaaatggtgatgattctaaactgcagcttgtt
gttaggactccacctgctgaatctttggaaagcgaagatgaagatggctttcctgtatca
ttttctgaatcaaagaaaagaactgatggtagttctaagaaaaaaggcaacctaaacaac
aagatgagcactgaagataggaaaaggaaaagcagtgctgttggcgaccatcatgaccct
tcaggggaagtaaaggatgaaaatgatggagtgtcaaagaaaaataaaaaggccaaggcc
aaaaagactgctgtgggcggtgtggaaaaggagatcaaacaggaagattctccagctgat
cttgttgatgcaaaacaaaagaaaaacaagaacaaaaatacctcagaagcagaagctggt
gctcatcagaataccgataagacaaaacatatccacactgatgctgaggaagacactgca
caggaggctagc

DBGET integrated database retrieval system