KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0512400-01
Entry
Os04t0512400-01   CDS       T02163                                 

Gene name
Os04g0512400
Definition
(RAP-DB) Similar to Midline 1 protein (Tripartite motif protein 18).
  KO
K10683  BRCA1-associated RING domain protein 1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Os04t0512400-01 (Os04g0512400)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dosa03019]
    Os04t0512400-01 (Os04g0512400)
   04121 Ubiquitin system [BR:dosa04121]
    Os04t0512400-01 (Os04g0512400)
   03036 Chromosome and associated proteins [BR:dosa03036]
    Os04t0512400-01 (Os04g0512400)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Negative regulators of mRNA 3' end processing
     Os04t0512400-01 (Os04g0512400)
Ubiquitin system [BR:dosa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    Os04t0512400-01 (Os04g0512400)
Chromosome and associated proteins [BR:dosa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     Os04t0512400-01 (Os04g0512400)
SSDB
Motif
Pfam: BRCT zf-HC5HC2H BRCT_2 zf-RING_UBOX zf-HC5HC2H_2 zf-C3HC4_3 PTCB-BRCT zf-RING_5 zf-C3HC4 zf-C3HC4_2 RTT107_BRCT_5 zf-C3HC4_4 zf-RING_10
Other DBs
RAP-DB: Os04t0512400-01
Position
chr04:complement(join(25615362..25615441,25615094..25615147,25614939..25615009,25614751..25614858,25614324..25614622,25614032..25614137,25613888..25613949,25613683..25613783,25613309..25613495,25613097..25613188,25612865..25612997,25612599..25612764,25612197..25612315,25611799..25612110))
AA seq 629 aa
MESFRRFLNPLVLNLQKMELELTCPVCLKLLNAPTMLPCYHTSCSKCATTRTMDGYSCAI
CKSAYRSQDLRPASHLEAIVNIHRSLSSTVSSMVTQQEAQADIPVAKTSFQGTPESGNRN
GAEKSDQVKSYTPVASKLAYNQSTGLAYGNVDGVKERNPALETRGAADVTAMPTILVQKG
PCRSQSSDGPRDLDCDSNDLEGELITSRSSPQSVLKREPNTANDDNRELKRQKSTDQDDR
QPAVAGAWKCEFCHSSKTTESTGPLSHYLHGEPLEDNQAWKPNVLHVHEKCIEWAPQAFF
TGDIANNLEPELARASKIKCSVCGLKGAALGCLVKSCRKSFHVPCAHGISGCRWDDENFV
MLCPSHSSKKLPCERSKSKNKKTSLQRSSSDTMLDDLNSPSTIHMDGLWTASPFLTSEWV
ICGSALSSQEKEILDQFEHQTGITVTNGWRSNVTHVIANTDECGACARTLKVLMAILAGK
WVLNINWLKACMEAKEPVPEEPYEISSDVHGSFDGPRMGRLRAMQNAPHLFAGLTFYFSG
HFMPNYKVHLEDLITAAGGSILDKADLSSTSLIIYSMEPPQGSDPDTLNEVIRKRKAEAE
ELAATIGSRAVPHTCVLDSIASCTVQLTM
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggagagcttcaggaggttcctgaacccgctggtgctcaacctgcagaagatggagctg
gagctcacctgccccgtctgcctgaagttgctcaacgcgcctaccatgctgccatgttac
cacacttcctgcagcaagtgtgctactacacggaccatggacggttacagctgcgcgatt
tgcaaatcagcttatcgttctcaagacctaaggcctgcctctcacctcgaggcaatagtg
aacatccacaggagcctaagctctacagtcagcagcatggtcactcagcaggaggctcaa
gctgatattcctgttgcaaagacatcatttcaaggaactccagaatcgggaaacagaaat
ggagcagagaaatctgatcaggtgaaatcatacaccccggttgcttctaaactggcatat
aaccagtcaactgggcttgcatatggaaatgtggacggcgtgaaagaaagaaatcctgca
ttggagactagaggtgcggctgatgtgactgctatgcccacaattcttgtgcagaaggga
ccctgccgatctcaatcttctgatggccctagggatctggattgcgacagcaatgacctt
gaaggagagctgataacaagcagatcatctcctcaaagtgtcttgaaaagagaaccaaat
acagcgaatgatgataatagagaattaaaaaggcaaaagtccactgatcaggatgataga
caaccagctgttgctggtgcttggaaatgtgaattttgtcactcttccaaaaccactgag
agtactggccctctgtcccattatctgcatggtgagccattagaggataaccaagcatgg
aaaccaaacgttttacatgttcatgagaagtgcattgaatgggcccctcaagcgttcttt
actggtgacattgcaaataacttggagcctgagttggcccgtgcttctaagatcaaatgc
agtgtttgtggactaaaaggtgcagcccttggctgccttgtcaagagctgccgcaagagc
tttcatgttccatgtgcccatgggatatcaggctgccgatgggatgatgagaactttgtt
atgctgtgtccttctcattcctcgaagaagttgccatgtgagagatcaaagtcaaaaaat
aagaagaccagcttgcagcgatcatcttccgatacaatgcttgatgacctgaactcacca
tctacaatccatatggatggactttggactgcttcaccttttctcactagtgaatgggtt
atatgtggatctgctctctctagtcaggagaaggaaatcttggaccagtttgagcaccaa
actggcatcactgtaactaacggttggaggtcgaatgtgactcatgtgattgctaatacg
gatgaatgtggggcatgtgccaggacactcaaggttctcatggccatactagctgggaaa
tgggttctgaatataaactggctgaaagcttgtatggaggctaaagaaccagtcccagaa
gagccttatgagatcagttctgatgttcatggctcctttgatggccctcgcatgggaaga
ctacgagcaatgcaaaatgcaccacatctgtttgcaggattgaccttttacttcagtggc
catttcatgcccaattacaaggttcaccttgaagatttgatcactgcagctgggggatca
atcttggacaaggctgatctctctagcacatccttgataatttacagcatggagccacca
caaggaagtgatcctgatacccttaatgaggtcatcagaaagaggaaggctgaggctgaa
gaattggcggcaacgattggctccagggctgttcctcatacatgtgttctggattctatt
gcatcatgcacagtgcaattgaccatgtga

DBGET integrated database retrieval system