KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0516600-01Help
Entry
Os04t0516600-01   CDS       T02163                                 

Gene name
Os04g0516600
Definition
(RAP-DB) Pyridoxal phosphate-dependent transferase, major region, subdomain 1 domain containing protein.
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00260  Glycine, serine and threonine metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
dosa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Os04t0516600-01 (Os04g0516600)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Os04t0516600-01 (Os04g0516600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
RAP-DB: Os04t0516600-01
Position
chr04:complement(join(25828797..25829239,25828566..25828677,25828194..25828244,25828027..25828098,25827813..25827945,25827660..25827718,25827469..25827566,25827129..25827195,25826937..25827020))
AA seq 372 aa AA seqDB search
MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVP
SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK
IVVAIRHPDGALYYPTTRLICLENTHANCGGKCLSAEYTDEVGEVAKSHGLKLHIDGARI
FNASVALGVPVHRLVKAADSVSVCISKGLGAPVGSVIVGSTAFIEKAKILRKTLGGGMRQ
VGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIVDSRI
SPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGSKKFEH
LTNGTTRNSYGH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccaacgtggtggacctacggtcggacacggtgacgaagccctccgacgcgatg
cgcgccgccatggccgccgcggacgtggacgacgacgtccttggcgccgacccgaccgcg
caccgcttcgagatggagatggcgaggatcacgggcaaggaggccgcgctgttcgtgccg
tccggcaccatggccaacctcatctccgtcctcgtccactgcgacaccaggggcagcgag
gtcatcctcggcgacaactcccacatccatatctacgagaacggcgggatctccaccatc
ggcggcgtccaccccaagaccgtcaggaacaaccccgatggaaccatggacatcgacaag
attgtcgtcgccatcaggcatccggatggggcgctgtattatccgaccacaaggctgatc
tgcctggagaatacccatgcaaactgtggtggaaagtgtctgtctgctgaatatactgac
gaggttggtgaagttgccaagagtcatggtctgaagcttcacatagatggagctcgcatt
tttaatgcttctgtggcccttggagttcctgttcatcgacttgtgaaagctgcggattca
gtctcggtgtgcatatctaaagggttaggcgctcctgttggatcagttattgttggttcg
acggccttcatagaaaaggctaaaattcttaggaagacactaggtggtggaatgaggcaa
gtgggaattctttgtgcggctgcctatgttgccgttcgcgacactgtaggaaaacttgct
gatgaccatagaagggctaaagttttagcagatggtctgaagaaaatcaagcattttaga
gttgatacaacttcagtggagaccaatatggtattctttgatattgtggattcacgcata
tcacctgacaaactgtgtcaagtccttgaacaacgcaatgtgcttgccatgccagcaggc
tcgaagagcatgaggcttgtcatccactaccaaatttctgatagtgatgttcagtatgca
ctgacatgcgtggagaaagctgctgaagaaatactgacaggcagtaagaagtttgaacat
ctgacaaacggtactaccaggaattcatacgggcactag

DBGET integrated database retrieval system