KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0535600-01Help
Entry
Os04t0535600-01   CDS       T02163                                 

Gene name
Os04g0535600
Definition
(RAP-DB) Similar to Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose 1) (Invertase 1).
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00052  Galactose metabolism
dosa00500  Starch and sucrose metabolism
dosa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Os04t0535600-01 (Os04g0535600)
   00500 Starch and sucrose metabolism
    Os04t0535600-01 (Os04g0535600)
Enzymes [BR:dosa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Os04t0535600-01 (Os04g0535600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 FLgD_tudor
Motif
Other DBs
RAP-DB: Os04t0535600-01
Position
chr04:join(26765513..26765915,26766100..26766108,26766239..26767110,26770531..26770692,26770843..26771084,26771337..26771424,26771529..26771723)
AA seq 656 aa AA seqDB search
MIPAISPMMDGAAPLLPETSPESRQQRDPERGKRRTPVLPAVVASAVVLLGLAALFLVYG
FHDGGDGRAAVLAPGTVEVAASSSRGVVEGVSEKSTTPALRLGGGAVRDYAWTNSMLSWQ
RTAFHFQPPNNWMNDPNGPLYYKGWYHLFYQWNPDSAVWGNITWGHAVSRDLIHWLHLPL
AMVPDHWYDINGVWTGSATQLPDGRIVMLYTGATEESVQVQNLAEPADPNDPLLREWSKA
EANPVLVPPPGIGLTDFRDPTTAWRNPADSAWRITIGSKDRDHAGLALVYKTEDFLHYDL
LPTLLHVVKGTGMWECVDLYPVSTSPAVEDGLETSTPPGPGVKHVLKASLDDDRNDYYAI
GTYDGETDTWTPDNADIDVGIGLRYDYGKFYASKTFYDPVGRRRVLWGWIGETDSERADI
LKGWASLQSIPRTVMLDTKTGSNLLQWPVVEVENLRMRGKSFDGLDVSPGSVVPLDVGKA
TQLDIEAVFEVDTSAADGVVTEAGAAAYSCGTGGGAVGRGLMGPFGLLVLADDQLSERTA
VFFYLVKGVDGNLTTFFCQDELRSSKANDLVKRVYGSLVPVLDGENLSIRILVDHSIVEG
FAQGGRTCITSRVYPTKAIYESAKIFLFNNATNVRVTAKSLKIWELNSAYIRPYVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggccatctccccgatgatggacggcgccgcgcctctgcttcccgagacgagc
cccgagagccgccagcaacgtgatccggagagggggaagaggcggacgccggtcctcccg
gccgtcgtcgcgtccgccgtggtccttctcggcctcgcggcgctcttcctggtgtatgga
tttcacgacggtggagacgggagggcggccgtactcgcgcccggcaccgtggaggtcgcg
gcctcgtcgtcccgcggcgtcgtggagggcgtctcggagaagtccaccaccccggcgctg
cgcctcggcggcggcgcggtccgggactacgcctggaccaactcgatgctgtcctggcag
cgcacggcgttccacttccagccccccaacaattggatgaacgatccgaacggtccactg
tactacaagggatggtaccatctgttctaccaatggaacccggactcggccgtgtggggg
aacatcacctggggccatgccgtgtcgcgcgatctcatccactggctgcacctgccgctc
gccatggtgcccgaccactggtacgacatcaacggcgtctggaccggctcggcgacgcag
ctgcccgacggccggatcgtcatgctctacaccggcgccacggaggagtcggtgcaggtg
cagaacctggccgagccggccgacccgaacgacccgctgctgcgggaatggagcaaggcg
gaggcgaacccggtgctggtgccgccgccgggcatcgggctgacggacttccgcgacccg
acgacggcgtggcgcaacccggccgactcggcgtggcggatcaccatcgggtccaaggac
cgcgaccacgcggggctggcgctcgtgtacaagacggaggacttcctgcactacgacctg
ctgcccacgctgctgcacgtcgtcaagggcaccggcatgtgggagtgcgtggacttgtac
ccggtgtccacctcgccggccgtcgaggacgggctcgagacgtccaccccgccggggccc
ggcgtgaagcacgtactcaaggccagcctcgacgacgacagaaacgactactacgccatc
ggcacctacgacggcgagaccgatacctggacgccggacaacgccgacatcgacgtcggg
atcgggctccggtacgactacggcaagttctacgcgtccaagacgttctacgaccccgtc
gggcggcgtcgcgtgctatgggggtggatcggcgagaccgacagcgagcgggctgacata
ctcaagggctgggcctcccttcagtcaattccgaggacagttatgctggacacgaagact
ggcagcaacctgctccagtggccggtggtggaggtggagaacctccgtatgcgcggcaag
agcttcgacggcctcgacgtctctcccggctccgtcgtgccgttggacgtcggcaaagca
acacagctggacatcgaggccgtgttcgaggtggacacttcggcagccgacggtgtcgtc
acggaggctggagcagcagcatacagctgcggcacgggcggcggtgcggttggccgtggc
ttgatgggcccgttcgggcttctcgtgctggccgatgatcagttgtcggagcggacggct
gtcttcttctacctggtcaagggagtcgacggcaaccttacaaccttcttctgccaagac
gagctcaggtcatcaaaagcaaacgatctagttaagagagtctatggcagcttggtacct
gtgctagatggcgaaaacctgtcaataaggattttggttgatcactccatagttgagggc
ttcgctcaaggagggaggacatgcattacctcgcgtgtgtatcccaccaaagccatctac
gagtcggccaaaatctttcttttcaacaatgccacaaatgttagagtcactgccaaatcg
ctaaagatttgggagctgaactctgcttacatccgtccatatgtagactag

DBGET integrated database retrieval system