KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0624000-01
Entry
Os04t0624000-01   CDS       T02163                                 

Gene name
Os04g0624000, ATG8B, AUTOPHAGY_ASSOCIATED_GENE_8B
Definition
(RAP-DB) Similar to Symbiosis-related like protein.
  KO
K08341  GABA(A) receptor-associated protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    Os04t0624000-01 (Os04g0624000)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dosa04131]
    Os04t0624000-01 (Os04g0624000)
   04121 Ubiquitin system [BR:dosa04121]
    Os04t0624000-01 (Os04g0624000)
   03029 Mitochondrial biogenesis [BR:dosa03029]
    Os04t0624000-01 (Os04g0624000)
Membrane trafficking [BR:dosa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    Os04t0624000-01 (Os04g0624000)
Ubiquitin system [BR:dosa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   Os04t0624000-01 (Os04g0624000)
Mitochondrial biogenesis [BR:dosa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Os04t0624000-01 (Os04g0624000)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
RAP-DB: Os04t0624000-01
Position
chr04:complement(join(31718770..31718806,31717647..31717702,31717505..31717557,31716813..31716931,31716573..31716667))
AA seq 119 aa
MAKSSFKLDHTLERRQAEANRIREKYSDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQ
FVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGLL
NT seq 360 nt   +upstreamnt  +downstreamnt
atggccaagagctcgttcaagctggaccacacgctcgagaggaggcaggctgaggctaac
cgtatcagagaaaagtacagtgacagaattcctgtgattgttgagaaagctgaaagaagt
gatattcctgacatcgacaagaaaaagtacctggtccctgctgatcttaccgttgggcag
tttgtctatgttgttcggaagcggatcaagctcagtcctgagaaagcaatcttcatcttt
gtgaagaatactcttccaccaacagctgctctgatgtccgcaatttacgaggagaacaag
gatgaggatgggttcctctacatgacctacagtggcgagaacacctttgggctgctctag

DBGET integrated database retrieval system