KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0645100-01
Entry
Os04t0645100-01   CDS       T02163                                 

Gene name
Os04g0645100, FLO2, FLOURY_ENDOSPERM_2
Definition
(RAP-DB) Tetratricopeptide repeat (TPR) domain containing protein, Grain size and starch quality
  KO
K03255  protein TIF31
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dosa03012]
    Os04t0645100-01 (Os04g0645100)
Translation factors [BR:dosa03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    Os04t0645100-01 (Os04g0645100)
SSDB
Motif
Pfam: TPR_12 eIF3_p135 TPR_10 CLU_N TPR_2 PAM2 TPR_9 TPR_MalT TPR_8 TPR_1 CLU
Other DBs
RAP-DB: Os04t0645100-01
Position
chr04:join(32835314..32835398,32836039..32836100,32836393..32836485,32836781..32836853,32839678..32839983,32840069..32840127,32840240..32840371,32840506..32840547,32840652..32841185,32841281..32841471,32841630..32842119,32842365..32842427,32842796..32842897,32842987..32843307,32843386..32843478,32843576..32843677,32843810..32843914,32844025..32844158,32844521..32844704,32845318..32845449,32845539..32845651,32845720..32845801,32846420..32848084)
AA seq 1720 aa
MAPKGAGRGKGRGGGGGGKGDKRKKEEKVVPSAIDVTVVTPYESQVTLKGISTDRVLDVR
KLLGSNVETCHLTNYSLSHVTRGQRLEDGVEIVSLKPCSLTIVEEEYATEAAAAAQVRRL
LDIVACTTAFVNKPRDGAKHKSSKHARPATPPSPPALAASPDAHGAGAAQAPPISEAHDM
AAIRPPPRLGEFYDFLSFAHLTPPVHFIRRKESNGASQEGDYFEIEVKVCNGKLLHIVAS
VKGFYSAGKPHTVSHSLVDLLQQLSSAFANAYDALMKAFLDHNKFGNLPYGFRANTWLIP
PIYLDSATKCPALPVEDENWGGNGGGNGRDGKYDRRRWAKEFSTLARMPCKTEEGRVIRD
RKAFLLHNLFVDTAIFRAASTIQRLIDLSGNSTSQQAGLDGSLAIEERVGDLLITVKRDQ
ADASLKLEDKVDGVALYQTGSMDISQRNLLKGLTSDESVVVKDTSILGVVIVKHCGYTAT
VKVSGRTKDGNGGKQTSDICDHLDGISNVDVDDLPDGGSNALNINSLRISLPKIVNSDIA
STQCPTPQSHVDNHARKLVRKILEDSLMKLENMPANNPRTIRWELGSSWLQNLQKKDSPA
SEDKKNAGHVEKETTIKGLGKHFEQLKKIKKKECHVEGAMSEKEDSDSNCSVINGMEESE
NTKETDISKLMSEDDFCRLKDLGAGLHQKSLEELTMMAHKFYDDTALPKLVADFASLELS
PVDGRTMTDFMHTRGLNMCSLGRVVELAEKLPHIQSICIHEMVIRSFKHIVRAVIAAVDD
MQNMSAAIAETLNILLGCPRLESGTETDAHSEHNLRFRWVERFLSKRYNWKLKDEFAHLR
KFIILRGLCSKVGLELVARDYDMNSPNPFDKSDIVNIIPVCKHVVYSSIDGRNLLESSKM
ALDKGKLDDAVNFGTKALSKIVAVCGPYHRLTANAYSLLAVVLYHTGDFNQATIYQQKAL
DINERELGLDHPETMKSYGDLSVFYYRLQHIEMALKYVNRALYLLQFSCGLSHPNSAATY
INVAMMEEGMGNVHVALRYLHEALKCNKRLLGADHIQTAASYHAIAIALSMMDAYSLSVQ
HEQTTLQILQEKLGQDDLRTQDAAAWLEYFESKALEQQEAARRGIPKPDSSIASKGHLSV
SDLLDYISPDQERKERDTQRKGRRAKNNIRAHQGELVEEKESFEHDIGSPHEANKEEFQQ
VKSKAHPPAISEENYAIHDELKQVDPLSPEEYSDEGWQAANLRGRSANVRKKSSRRRPAL
TKLMVDRLEDGRTGSAYRAGVQQHMKGDKEDVINSSSQLSFGSFLKTDKVNGNSSNIENK
VFNAISKPERGIKLSGINRPATIASKLVSYKDVAVSPPGTVLKPILEQKEAKEKDNAQNT
DLIVSSEEEDKKLTDEDEEKEKPSHDSSKEVLSSEPEEIGNDEKAPDSNSDESPTESKKK
GGSKLSASAPPFNPGSLLSMSHPYSTVAIYDASVVLQPIPSQPMEILPHAIDTRVPRGPR
STLYYRTGHTFQRKQGYAHSQSTILRGSNSPPTMNPHAAEFVPGKTSQQPDVANREPSAD
VSVTDSADQLLAPQTSDEVKAGMPAAEQAIQGESTSPCKGKENRAKDALRNSCKTELARQ
ILFSFIVKSVHDSLGSTGAESDRKPSGPDESGNAQSSNNINKSPSGRKELDKQQKATVVP
KSEKDTEGFTVVSKRRRSKQHFVHPIHGLYSQQSICTSVS
NT seq 5163 nt   +upstreamnt  +downstreamnt
atggcccccaagggcgccggccgtggcaagggcaggggcggcggcggcggcggcaaaggc
gacaagaggaagaaggaagagaaagttgtgccgagtgccatagacgtcacggttgtcact
ccctatgaatcccaggttacactcaaggggatatctacggaccgtgttctggacgtgagg
aagctgctgggctcgaatgtggagacgtgccacctgacaaactactcgctctcgcacgtg
acgcgagggcagcggctggaggacggcgtggaaatcgtgtcgctgaaaccatgctctctc
accatcgtggaagaggagtacgcgacggaggcggcggcggcggcgcaagtccggcggctg
ctggacatcgtcgcctgcaccaccgcgttcgtgaacaagccccgcgacggcgccaagcac
aagtcgtccaagcacgcgcgcccggcgacgccgccgtcaccgcccgcgctcgccgcctcc
cccgacgcccatggcgccggcgccgcccaggcgccgccgatatcggaggcgcacgacatg
gcggccatccgtccgccgcccaggctgggcgagttctacgacttcctctccttcgcccac
ctcaccccgcccgtccactttatcaggaggaaggagagcaatggcgcttctcaggaaggc
gactacttcgaaatcgaggtgaaagtttgcaatgggaagctcctgcacatcgttgcttcc
gtcaagggcttctattcggcagggaagccgcacaccgtgagccactccttggtggatctg
ttgcaacagctcagcagtgcatttgccaatgcatatgatgcactgatgaaagcttttctg
gatcacaacaagtttgggaatctaccatacggatttcgtgcaaacacatggcttattcct
cctatatacttggattctgctacaaagtgcccagcattaccagttgaggatgagaattgg
ggtggaaacgggggtggcaatgggcgagatggaaagtatgacagaagacgatgggcaaaa
gaattttctactttggctagaatgccatgcaaaactgaggaagggagggtgatcagagac
cggaaggcttttcttttacacaatctctttgtagatacagcaatttttagagctgcatca
acaatacagagactcattgatctgtctgggaactcaactagtcaacaagctggcctagat
ggttctttagcaatcgaggaacgtgttggtgacttgcttataactgtaaagagggatcag
gctgatgctagtttaaagctggaggataaagttgatggagttgcactctatcaaaccggt
tctatggatatatcacaaagaaatcttctaaaaggtttaacttctgatgaaagtgtcgtt
gttaaggacacctcaatactcggagtggttattgttaaacattgtggatatacagcaaca
gtgaaggtttcagggcgcacaaaggacggaaatggtggcaaacaaaccagtgatatctgt
gatcatctcgatggaatttcgaatgttgatgtagatgatttgccagatggaggttctaat
gccttgaacattaacagtctaagaatatcactgccaaaaattgtcaactcagacatcgct
agtactcagtgtcctactccgcagtctcatgttgataatcatgcaaggaaactagtgcgc
aaaatacttgaagatagcttgatgaagctggagaacatgcctgccaataatcctagaacc
atcagatgggaacttgggtcatcctggctgcaaaacttgcagaaaaaggattcgccggca
tctgaggacaagaaaaatgcaggacatgttgaaaaagagacaactatcaaaggtcttggt
aagcactttgaacagctaaagaaaattaaaaagaaagaatgccatgttgaaggtgctatg
tctgagaaggaagactctgacagtaactgctctgtcataaatggcatggaagaatctgaa
aacaccaaggagactgatattagcaagctgatgtcagaggatgatttctgtcgccttaag
gatctgggagctggacttcatcaaaagtcccttgaagagctcactatgatggcccataaa
ttctatgatgatactgcgcttccaaagctggtggctgattttgcttcccttgaactttct
cctgtggatggaagaaccatgaccgatttcatgcacacaaggggtcttaatatgtgctcc
ttaggccgtgtggtagagctcgcggagaagcttccacatatccagtcaatttgcatccat
gaaatggtcattaggtcctttaagcacattgttcgagctgttattgcagctgttgatgac
atgcaaaatatgtctgcagctattgctgagactttaaacattttacttggatgcccaaga
cttgaaagtggcactgaaacagatgcacatagtgaacataatttgagatttagatgggta
gagaggttcctttctaaaaggtacaattggaaattgaaagatgaatttgcacacttgcgg
aaatttatcattctgagaggtctttgcagtaaggttggacttgagttggttgcgagagat
tatgatatgaatagcccaaatccatttgacaaatctgacatagttaacattattcctgta
tgcaagcatgtggtgtactcttctattgatggtcgaaacttattagaatcatcaaagatg
gctttggataaaggaaaacttgatgatgccgtcaacttcggaacaaaggcgttgtccaaa
attgtagcagtttgtggtccataccatcggctgactgctaatgcgtacagtcttcttgct
gtagttctttaccatactggagattttaatcaggcaactatatatcagcagaaggcactt
gatatcaatgaaagagagctaggtcttgaccacccagaaactatgaagagttacggggat
ttatctgtcttctactaccgtctccagcacatcgaaatggctctaaagtatgtcaaccgt
gcactatatctactccaattttcttgtgggctttcacatccaaattcagctgccacatac
ataaatgtggctatgatggaagaaggtatgggaaatgttcatgtcgctctcaggtacttg
catgaagcactgaagtgcaacaagagactgctaggagctgatcacattcagactgctgcg
agctatcatgccatagccatagccctctcaatgatggatgcatactccttgagtgttcag
catgaacagaccaccttacagatacttcaggagaaactaggacaagatgaccttcgaact
caggatgctgctgcatggcttgagtattttgagtcaaaagcattagaacaacaagaggcc
gcccgaaggggcatcccaaaacctgactcatctattgcaagcaaaggacatcttagtgta
tcagatctacttgactacataagcccggatcaggaaagaaaagagagggatacacaaaga
aagggcaggcgtgcaaagaataatatcagagcccatcaaggtgaattagttgaagaaaag
gagagctttgagcacgacataggatctcctcatgaagcaaacaaagaggagtttcaacaa
gtaaaatcgaaggcacaccctccagcaatatcagaagaaaattatgctatccatgatgag
ctgaagcaagttgatcctttatcacctgaagaatattctgatgaagggtggcaagcagct
aatttgcgtggacgatctgcaaatgtacggaagaaaagcagtcgcagaaggcccgctctc
actaaattaatggttgatcgcttggaagatggccgcacaggttctgcttatagggctggt
gtacaacaacacatgaaaggagataaagaagatgttataaactcttctagccagctctcc
tttggcagctttctaaaaactgacaaggtgaatgggaattccagcaatattgaaaataag
gttttcaatgctatatctaaaccagaacgaggcataaagctttcaggaattaacagacct
gctactatagcttccaagttggtatcatacaaagatgtagcagtgtcaccccctggcaca
gtcttgaaaccgattttggagcagaaggaagcaaaggagaaggataatgcacaaaatact
gatctaatagtgtcatctgaggaggaagataagaagttaacagatgaagatgaagaaaag
gaaaagccaagtcatgacagcagcaaagaggttctttcaagtgaaccagaggaaatcggc
aatgatgaaaaagctccggacagcaacagtgatgaaagcccaactgaatctaagaaaaaa
ggtggaagcaagctttcagcttcagcgcctccattcaatcctggatcactcttatcgatg
tcgcacccttacagtacagtggcaatatatgatgctagcgtcgttcttcagccaatacca
agtcaaccaatggagattctccctcacgccattgatactagggtaccccgtggtcctcgg
tccacattgtactaccgtactgggcataccttccaaagaaaacagggttacgcacacagc
cagagcaccattctgaggggtagcaactcccccccaaccatgaatcctcatgctgccgag
tttgtgcctggaaaaacttcgcaacaacctgatgtggctaacagagagcctagtgcagat
gtttctgtaactgattcagcagatcaactgttggcaccacagacatcagatgaagtaaag
gctggtatgcctgcagcagaacaagcaattcaaggtgagagcaccagcccatgcaaagga
aaggaaaacagagcgaaagatgccttgagaaactcatgcaaaacagagctggcaaggcag
attttgttcagtttcatcgtcaagtcagtacatgatagcttaggttccactggagctgaa
tcggacagaaaaccaagtggaccagacgaatctggtaatgcacagagcagcaacaacata
aacaagagtccgtcaggtcgcaaagagcttgacaaacagcagaaggccaccgtggtacct
aagagtgagaaggatacagaaggatttacagtagtttcaaaacgtagaagaagcaagcag
cactttgtgcatcccatacatggtctctattcccagcagtcaatttgcacttctgtcagc
taa

DBGET integrated database retrieval system