KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0684500-01
Entry
Os04t0684500-01   CDS       T02163                                 

Gene name
Os04g0684500
Definition
(RAP-DB) Pentatricopeptide repeat domain containing protein.
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
SSDB
Motif
Pfam: PPR_2 PPR_3 PPR_1 PPR PPR_long RRM_1 TPR_19 MRP-S27 MA3 RRM_7 ParBc
Other DBs
RAP-DB: Os04t0684500-01
Position
chr04:join(34958669..34959451,34960384..34960511,34960958..34961098,34961319..34961405,34961490..34961643,34963432..34963491,34963882..34964310,34964387..34964682,34965141..34965270,34965553..34966050)
AA seq 901 aa
MQFLSLSAAAASSPAAAVLPPKPFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPPPHRPSP
SPPPNPLSSKLWLSSKLSPPPPETLEQPEPSTTTTTTTPPPPEPEAEAEARRQEEFRHKG
KVFVGNLPLWARKAEIAEFFRQFGPLEKVELVRGHDDPERNVGFCFLYYGGDDADAAAER
AVEVDGVDFRGRSLTVRLDDGRKGRARAEQRARWVNDGRRREPRSPWHEGRDEACREFRR
VVESRPDNWQAVVSAFERIPKPSRREFGLMIVYYAKRGDKHHARATFENMRARGIEPNAF
VFTSLVHAYAVARDMRGALSCVEEMKSEGLELTIVTYSILISGFAKINDSQSADNLFKEA
KTKLSSLNGIIYSNIIHAHCQSGNMERAEELVREMEEDGIDAPIDVYHSMMHGYTIIQNE
NKCLVVFERLKECGFKPSIISYGCLLNLYVKIGKVAKALSISKEMESCGIKHNNKTYSML
INGFIHLHDFANAFAIFEEMLRSGLQPDRAIYNLLIEAFCKMGNMDRAICILEKMQKERM
QPSNRAFRPIIEGYAVAGDMKSALDTLDLMRRSGCVPTVMTYNALIHGLVRKHKVQRAVS
VLDKMSIAGITPNEHTYTIIMRGYAASGDIGKAFEYFTKIKESGLKLDVYIYETLLRACC
KSGRMQSALAVTREMSFQKIPRNTFIYNILIDGWARRGDVWEAEDLMKQMKEDGVPPNIH
TYTSYINACCKAGDMQRAEKVIEEMVDVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEM
KLAGLKPDEASYHCLVTSLLSRATVMEGSTYTGIISVCREMSENDLTVDLRTAVHWSRWL
HKIERTGGALTEALQRIFPPDWNSLEFLGEPSSSISMGESDDYSDSDFSGDEDEDHNIDD
S
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgcagttcctctcgctctccgccgccgccgcctcctcgccggcggccgccgtcctccca
ccgaagccattcaaacccctctcctccgcggcccccttccgtcgcccctccccgcctccg
ccgcctccgtccccggtgccctcacccgcgccaccgccaccgccgcatcgcccttctcct
tctcctcccccgaaccccctctcctccaagctatggctgtccagcaagctctccccgccg
ccccccgagacactagagcagccagagccttctactactactactactactaccccgccg
ccgccggaaccggaggcggaggcggaggcgcggcggcaggaggaattccggcacaagggg
aaggtcttcgtcgggaaccttccactgtgggccaggaaggcggagatcgccgagttcttc
cgccagtttgggcccctggagaaggtcgagctcgtgcgcggccacgacgatcccgagcgc
aacgtgggcttctgcttcctatactacggaggcgacgacgcggacgccgcggcggagcgt
gcggtggaggttgacggggttgacttccgtgggaggtcgctcaccgtgaggcttgacgac
ggcaggaaagggagggccagggctgagcagcgggcgcgctgggtgaacgacggccggagg
cgcgagccacggtcgccgtggcacgagggcagggacgaggcgtgccgtgagttccgcagg
gtggtggaatcacggcccgacaactggcaggccgtcgtctctgcattcgagaggataccc
aagccatcaaggagagaattcggtctgatgattgtttattatgccaagcgaggtgataag
catcatgctcgtgcaacatttgagaacatgagagcaagaggaatagagcccaatgcattt
gtttttacaagccttgttcacgcttatgcagttgctagagatatgcgtggagctctgtct
tgcgttgaggaaatgaaatctgagggtcttgagctgacaattgttacctacagtatcctt
atttcaggattcgccaaaattaatgattcccaatctgcagataacttgttcaaagaggct
aagaccaagcttagcagtctcaatggaatcatatatagtaacatcatacatgctcactgt
caatctggcaatatggaacgggctgaagaactggtgcgtgaaatggaagaggatgggata
gatgctcctatagatgtatatcacagtatgatgcatggatataccatcattcagaacgaa
aataaatgtctagttgtctttgaacggcttaaggagtgtggctttaaaccatcaataatc
tcttatgggtgccttcttaatttgtatgtcaagataggtaaggttgccaaagcattatct
attagcaaagaaatggagtcttgtggcatcaaacataataataaaacatactctatgctt
atcaatggatttatccatttgcacgactttgcaaatgctttcgccatatttgaggaaatg
ctaagatcaggtctacaacctgatcgtgccatatacaatttgcttatagaggcattttgt
aagatgggaaacatggatcgtgctatttgcattttggaaaaaatgcagaaggaacgaatg
caaccatcaaatagagcattcaggcctatcatagagggatatgcagttgctggtgatatg
aaaagtgctttggatactcttgatctgatgcggcgaagtggttgtgttcccactgtaatg
acttacaatgctctcattcacgggctagttagaaagcacaaggttcaaagagctgtctct
gtgcttgataagatgtccatcgctggcattacaccaaatgagcatacatacacaatcatt
atgagaggttatgctgccagtggagatattgggaaggcttttgaatacttcaccaaaata
aaagagagtggtctaaaactcgatgtgtacatttatgaaacattgctcagagcctgttgc
aaatcagggaggatgcagagtgccttagcagtcactcgtgagatgagcttccaaaagata
ccaaggaatacatttatatataatattttgattgatggatgggctcggagaggtgatgtt
tgggaagcagaggacttgatgaagcagatgaaagaagatggtgtccctcctaacatccat
acttatacctcctatataaatgcatgctgcaaggcaggagacatgcagagagcagaaaag
gtgattgaagaaatggtagatgttggactaaaacctaatgtcaagacatatactaccttg
attaaaggttgggcaagagtgtcacttccagacagggcattgaaatgctttgaggagatg
aaacttgctgggttgaaacctgatgaggcttcttatcattgcttggtgacttcacttctg
tcaagggcaactgtaatggagggaagtacctacacaggaatcattagtgtctgtagagaa
atgtctgagaatgatttgactgttgatcttcgcactgctgttcactggtctagatggctt
cacaagattgagaggactggaggggcactaacagaagcgcttcagagaatatttcctcct
gattggaattcattagaatttttaggagagccatccagttctataagcatgggggagtct
gatgattacagtgattcagattttagcggtgatgaagatgaggatcataatattgatgat
agctga

DBGET integrated database retrieval system