KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0685100-01Help
Entry
Os04t0685100-01   CDS       T02163                                 

Gene name
Os04g0685100
Definition
(RAP-DB) Ribosomal biogenesis regulatory protein family protein.
  KO
K14852  regulator of ribosome biosynthesis
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os04t0685100-01 (Os04g0685100)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    Os04t0685100-01 (Os04g0685100)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRS1 WW_FCH_linker
Motif
Other DBs
RAP-DB: Os04t0685100-01
Position
chr04:complement(join(34994618..34994733,34994389..34994539,34993811..34993862,34993563..34993691,34993126..34993243,34992784..34992970,34992577..34992690,34992339..34992464))
AA seq 330 aa AA seqDB search
MAEAAAAPPAAAATNYEVDLGNLMAYDPSHHLPAASSSREELREECLRKGTELAQAVADA
LFALPATEDRDGPMVRLPPPTTRFPREKHLPRPKPPTKWEQFAKMKGITKHKKNKREWDE
QTQTWKRTYGYDRVNDDKDIPIIEAKATDEPGVDPFAQRREDKKKHVEKQEKNRLENLKK
AAKVGALPSHIQLAATALPITGTKADIPKKSRKKDLEDVAGMASSATASGGKFDEKLPGE
KPPKNPGKHRKFLPVVEGKGMGNQEKQQNDKILNALLAKSSEDQMDVGRAITMYKVKKEK
QRRKDKEKSSSSNKLKPQKKTLKKSSKKKA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagcagcagcacctcccgccgccgccgccaccaactacgaggtggacctc
ggcaacctcatggcctacgacccgtcgcatcacctccccgccgcatcctcctccagggag
gagctgagggaggagtgcctgcggaaggggacggagctggcgcaggcggtcgccgacgcc
ctcttcgcgctgccggccaccgaggaccgcgacggccccatggtccgcctcccgccgccc
accacccgcttcccccgcgagaagcatctaccaaggccgaagccccctactaaatgggag
cagtttgcgaagatgaaagggatcacaaagcacaagaagaacaaacgtgaatgggacgag
caaactcaaacctggaagcggacttatggctatgaccgtgttaatgatgataaagacatt
ccaatcattgaagccaaggcgacagatgagcctggtgttgatccttttgctcaaagaagg
gaagataagaagaagcatgttgaaaagcaagaaaagaacagactagaaaacttgaaaaaa
gcagccaaagttggtgctttgcctagtcatatacaacttgctgcaacagcgttgcctatc
acgggaactaaagcagacatacccaaaaaatctagaaagaaagatctcgaggatgttgct
ggcatggcttcatcagcaacagctagtggtgggaagttcgatgaaaaattgcctggcgag
aaacctccaaaaaatcctggcaaacatagaaagttcctccctgttgttgaaggaaaagga
atgggcaaccaggagaaacagcaaaatgacaaaatcttgaatgctctgctggccaaaagt
tctgaggatcaaatggatgttggcagggcaattacgatgtacaaggtgaagaaggagaaa
caaaggaggaaagataaggaaaagtcttcttcatcgaacaagctgaagccccagaagaaa
acactcaagaaatcttcgaagaaaaaggcttag

DBGET integrated database retrieval system