KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0196600-00
Entry
Os05t0196600-00   CDS       T02163                                 

Gene name
Os05g0196600, ACC_SYNTHASE_3, ACS3
Definition
(RAP-DB) Similar to 1-aminocyclopropane-1-carboxylic acid synthase.
  KO
K01762  1-aminocyclopropane-1-carboxylate synthase [EC:4.4.1.14]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00270  Cysteine and methionine metabolism
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Module
dosa_M00368  Ethylene biosynthesis, methionine => ethylene
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Os05t0196600-00 (Os05g0196600)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dosa01007]
    Os05t0196600-00 (Os05g0196600)
Enzymes [BR:dosa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.14  1-aminocyclopropane-1-carboxylate synthase
     Os05t0196600-00 (Os05g0196600)
Amino acid related enzymes [BR:dosa01007]
 Aminotransferase (transaminase)
  Class I
   Os05t0196600-00 (Os05g0196600)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
RAP-DB: Os05t0196600-00
Position
chr05:complement(join(5956118..5956291,5955874..5955993,5955595..5955755,5954551..5955454))
AA seq 452 aa
MVGRMLSSPEPTLSTMAMSAAHGEDSPYFAGWRAYDEDPYDPITNPQGVIQMGLAENQVS
FDLLEEYMREHPEASDCGAGVRENALFQDYHGLKSFRKAMASFMETIRGGKARFDPDRVV
LTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVNIVPVSCDSAAGFQVTA
GALRAAYDEAVAAGTRVRGVLITNPSNPLGTTAARGVLEGILDFVARHDMHLISDEIYSG
SVFAAPDLVSVAELVDERRRARGGAADAEDIARRVHVVYSLSKDLGLPGFRVGVVYSYND
AVVAAARRMSSFTLVSSQTQRTLAAMLSDAAFAAAYVRSNRDRLRERHARAVAGLRRAGV
ACLRGANAGLFVWVDMRRLLGDGEATVAGELRLWRRVVAEAKLNISPGSSCHCREPGWFR
VCFANMSLETLDVALHRLGCFIKKWEQEQHEN
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggttggcaggatgctttcttccccagagcctacactgtcaaccatggcgatgtcggcg
gctcacggcgaggactcgccgtactttgcagggtggagagcctatgatgaggacccctat
gaccccatcaccaatcctcaaggtgtcatacagatgggccttgcagaaaaccaggtttcc
tttgatcttctagaggaatacatgagggagcacccggaggcgtcggattgcggcgccggg
gttcgagagaacgccctgttccaggactaccatggcctgaaatcattcaggaaggcaatg
gcgagcttcatggagacgataaggggaggcaaggcgaggttcgacccggaccgcgtcgtc
ctcaccgccggcgccaccgccgccaacgagcttctcaccttcatcctcgccgaccccggc
gacgccctcctcgtccctaccccttactacccagggtttgacagggacttgaggtggagg
accggcgtgaacatcgtcccggtgagctgcgacagcgccgccgggttccaggtcaccgcc
ggcgcgctccgggccgcgtacgacgaggccgtggcggcggggacgcgcgtccgcggcgtg
ctcatcacgaacccgtcgaacccgctcggcacgacggcggcgcgtggcgtcctcgagggc
atcctcgacttcgtggcgcgccacgacatgcacctcatctccgacgagatctactccggc
tccgtgttcgccgcgccggacctggtcagcgtcgcggagctcgtcgacgagcgccgccgc
gcgcgcggcggcgccgccgacgccgaggacatcgcccggcgcgtccacgtcgtgtacagc
ctctccaaggacctgggcctcccggggttccgcgtcggcgtggtctactcctacaacgac
gccgtggtggccgcggcgaggcgcatgtcgagcttcacgctggtgtcgtcgcagacgcag
cggacgctcgccgcgatgctgtccgacgcggcgttcgcggcggcgtacgtgcgctccaac
cgcgaccgcctccgggagcggcacgcgcgcgcggtggccgggctgcggcgcgccggcgtg
gcgtgcctccgaggcgccaacgccgggctgttcgtgtgggtggacatgcgccgcctgctg
ggcgacggcgaggccaccgtcgccggcgagctgaggctgtggcggcgcgtggtcgccgag
gcgaagctgaacatctcgccggggtcgtcgtgccattgccgggagccggggtggttcagg
gtgtgcttcgccaacatgagcttggagacgctggacgttgcactccatagactgggctgc
ttcatcaagaaatgggagcaagaacaacatgagaattaa

DBGET integrated database retrieval system