KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0304800-01
Entry
Os05t0304800-01   CDS       T02163                                 

Gene name
Os05g0304800
Definition
(RAP-DB) Histone-fold domain containing protein.
  KO
K08066  nuclear transcription factor Y, gamma
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os05t0304800-01 (Os05g0304800)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os05t0304800-01 (Os05g0304800)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone Pax2_C CENP-X
Other DBs
RAP-DB: Os05t0304800-01
Position
chr05:13750163..13751146
AA seq 327 aa
MAIPTKEEVEQNEEDNTFSRLQLLAQQRHAMEEFWRRSQEQIEASAGNHEHILPIDCVKN
VIRPKNDAMMLSADTPTFVTKLCELFVQELTLRAWVCANSHNRDIILGTDIAEAITTTES
YHFLGNVLRSHKALGSTAPDIDTSARKHIKLDQMTSLYHPTQEMQASRLAGYPPHVPIYP
PIGQMGTQHKLSPFTFMMQGESLLNMKREKSLVNEVMVCTNKMSINNFDGATSIGGGSSS
DVAIVVQQGETTHPFSSQNACPSLEDNYVVPMPTGHVQSFSPPTNINVKKLHQEEKNIYS
QDVAEEDMSNESLEGSQKDEDLFLHEK
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcgattccaacaaaggaggaggtggagcagaatgaggaggacaatacattttcaagg
ttgcaattgcttgcacaacaacggcatgccatggaggaattctggaggaggagccaggaa
caaatcgaggcatctgcaggcaaccatgagcatatactaccaattgactgcgtgaagaat
gtcattcgaccaaagaatgatgctatgatgctatctgctgacacaccaacttttgtgaca
aaactttgtgagctcttcgtgcaggagctcaccctccgtgcatgggtatgtgccaactct
cacaaccgtgacatcatattaggcacagacattgctgaggcaatcaccaccactgaatcc
tatcactttcttggtaatgtacttcgtagccacaaggcactaggaagtactgctcctgac
atagatacttctgctaggaagcatattaagctagaccaaatgacctcactctaccatcct
acccaagaaatgcaggcctcacgtttagctgggtatccaccccatgttcctatatatcct
cctataggtcaaatgggaactcaacacaagctgtctccattcacttttatgatgcaagga
gaatctcttctcaacatgaaaagagaaaaatccctagttaatgaagtgatggtatgcacc
aacaagatgagcataaacaactttgatggagctactagtattggtggtggtagtagtagt
gatgttgctattgttgtccagcaaggggaaactacacacccattctcatcccagaatgca
tgtccttccctagaagataactatgttgttcccatgcctacgggacatgttcagagtttt
agccctcctactaatatcaatgtcaagaagctacatcaagaggagaaaaacatctattca
caagatgttgctgaagaggacatgtccaatgagtctttggagggaagccagaaggatgag
gacctatttcttcatgagaaataa

DBGET integrated database retrieval system