KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0463800-01
Entry
Os05t0463800-01   CDS       T02163                                 

Gene name
Os05g0463800
Definition
(RAP-DB) Similar to Nuclear transcription factor Y subunit B-3.
  KO
K08065  nuclear transcription Y subunit beta
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dosa03000]
    Os05t0463800-01 (Os05g0463800)
Transcription factors [BR:dosa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    Os05t0463800-01 (Os05g0463800)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C Bromo_TP TFIID-18kDa FRQ
Other DBs
RAP-DB: Os05t0463800-01
Position
chr05:complement(join(22773478..22773728,22773192..22773325,22771749..22771753))
AA seq 129 aa
MADGPGSPGGGGGSHESGSPRGGGGGGGGGGGGGGVREQDRFLPIANISRIMKKAIPANG
KIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKV
YLQKYREVR
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcggatgggccggggagcccggggggaggaggggggagccacgagagcgggagcccg
agggggggagggggaggagggggaggtgggggtgggggtgggggggtgagggagcaggac
aggttcctccccatcgccaacatcagccgcatcatgaagaaggccatcccggccaacggg
aagatcgccaaggacgccaaggagaccgtgcaggagtgcgtctccgagttcatctccttc
atcaccagcgaggcgagcgataaatgccagagggagaagcgcaagaccatcaacggcgac
gacttgctgtgggcgatggccacgctgggcttcgaggactacatcgagcccctcaaggtc
tacctgcagaagtacagagaggtgcggtga

DBGET integrated database retrieval system