KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0469800-00Help
Entry
Os05t0469800-00   CDS       T02163                                 

Gene name
Os05g0469800
Definition
(RAP-DB) Pyruvate decarboxylase (EC 4.1.1.1) (Fragment).
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00010  Glycolysis / Gluconeogenesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Os05t0469800-00 (Os05g0469800)
Enzymes [BR:dosa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     Os05t0469800-00 (Os05g0469800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
RAP-DB: Os05t0469800-00
Position
chr05:join(23065607..23066131,23066235..23066398,23066485..23067135,23067240..23067357,23067454..23067642,23067766..23067936)
AA seq 605 aa AA seqDB search
MELALVGDPSNGVAKPSCDSVGSLPAVSSKAVIHPPVTSAAGATLGRHLARRLVQIGATD
VFAVPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSV
LNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINN
LDDAHEQIDTAIATALRESKPVYISVGCNLAGLSHPTFSREPVPLFISPRLSNKANLEHA
VEAAADFLNKAVKPVMVGGPKIRVAKAKKAFAGIAESSGYPFAVMPSAKGLVPEHHPRFI
GTYWGAVSTTFCAEIVESADAYLFAGPIFNDYSSVGYSLLLKREKAVIVQPDRVVVGNGP
AFGCILMTEFLDALAKRLDRNTTAYDNYRRIFIPDREPPNGQPDEPLRVNILFKHIKELL
SGDTAVIAETGDSWFNCQKLRLPEGCGYEFQMQYGSIGWSVGATLGYAQAAKDKRVISCI
GDGSFQMTAQDVSTMLRCGQKSIIFLINNGGYTIEVEIHDGPYNVIKNWDYTGLIDAIHN
SDGNCWTKKVRTEEELIEAIATATGAKKDCLCFIEIIVHKDDTSKELLEWGSRVSAANSR
PPNPQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggagcttgccctggttggcgacccttcgaatggcgtggcgaagccgtcgtgcgactcc
gtcggctcgctgcccgccgtcagctccaaggccgtcatccacccgccggtgaccagcgcg
gcgggcgccacgctcggcaggcacctcgcgaggcgcctcgtgcagatcggcgccaccgac
gtgttcgccgtccccggggacttcaacctcaccctgctcgactacctcatcgccgagccc
gggctcaagctcatcggctgctgcaacgagctcaacgccgggtacgcggccgacggctac
gcccgcgcccgcggcgtcggcgcgtgcgccgtcacgttcaccgtcggtggcctcagcgtg
ctcaacgccatcgccggcgcctacagcgagaacctccccgtgatctgcatcgtcggcggg
cccaactccaacgactacggcaccaaccgcatcctgcaccacaccatcggcctcccggac
ttctcacaggagctccgctgcttccagaccatcacctgctaccaggccgtcattaacaac
ctcgacgacgcgcacgagcagatcgacaccgccatagcgacggcactaagggagagcaag
ccagtgtacatcagcgtgggctgcaacctggcgggcctctctcacccgacgtttagccgc
gagccagtgccgttgttcatctcgccaagattgagcaacaaggcgaacttggagcacgcc
gtcgaagccgcggcggacttcctgaacaaggcggtgaagccggtgatggtcggggggcca
aagatccgggtggccaaggcgaagaaggcgttcgccggcatcgcggagtcgagcgggtac
ccgttcgcggtgatgccgtccgccaagggcctcgtgccggagcaccacccgcggttcatc
ggcacgtactggggcgccgtgagcaccaccttctgcgccgagatcgtcgagtccgccgac
gcctacctcttcgccggcccgatcttcaacgactacagctccgtcggctactccctgctg
ctgaagcgggagaaggccgtcatcgtgcagcccgaccgcgtggtggtcggcaacggcccg
gcgttcggctgcatcctcatgactgagttcctcgacgcgctcgccaaacgcctcgaccgc
aacacgacggcgtacgacaactaccgccgcatcttcatccccgaccgcgagccgcccaac
ggccagcccgacgagccactcagggtcaacatcctcttcaagcacatcaaggagttgctg
tccggcgacaccgccgtcatcgccgagaccggtgactcgtggttcaactgccagaagctc
aggctccccgagggctgcgggtacgagttccagatgcagtacggctcgatcgggtggtcc
gtcggcgccacgctcggctacgcccaggcggccaaggacaagcgcgtcatctcctgcatc
ggtgacggtagcttccagatgacggcgcaggacgtgtcgacgatgttgcggtgcgggcag
aagagcatcatcttcctcatcaataatggtgggtacaccatcgaggtggagatccacgac
gggccgtacaacgtcatcaagaactgggactacaccggcctcatcgacgccatccacaac
tctgacggcaactgctggacaaagaaggtccggactgaggaggagctgatagaggcgatc
gcgacggcaacgggcgccaagaaagattgcctctgcttcatcgagatcatcgtgcacaag
gatgacacgagcaaagagcttctcgagtggggatccagggtatcggctgccaacagcagg
ccgccgaatccccagtga

DBGET integrated database retrieval system