KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0519500-01
Entry
Os05t0519500-01   CDS       T02163                                 

Gene name
Os05g0519500
Definition
(RAP-DB) Similar to Periodic tryptophan protein-associated region; WD40-like.
  KO
K14558  periodic tryptophan protein 2
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Os05t0519500-01 (Os05g0519500)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dosa03009]
    Os05t0519500-01 (Os05g0519500)
Ribosome biogenesis [BR:dosa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    Os05t0519500-01 (Os05g0519500)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 WD40_like YrhK Nup160 HPS3_N
Position
chr05:complement(join(25792317..25793522,25791448..25791699,25791255..25791347,25790704..25791075,25790141..25790231,25788809..25788939))
AA seq 714 aa
MNYRFHNLLGAPYRGGDAVFAGDSSVLLSAVGNRVASTDLSASSSLTLPFESSSNVTRLA
VSPSGDFLLSVDDAGRALYANLGRRAVLHRIAFKSAPSAVRFSPDGNLIAVAVGKLVQIW
RSPAFRKEFFPFHLLRTIPGFAAGVTAFDWSPDSSFLLASCKDLTARLLPVKKGLGGKPF
LFVGHRAAVVGAFFATDKKTGRVTGAYTITKDGAIFTWNLVEGSDDSPPPSPGTPEQEAV
QDGEAELDGDEPELDGGSRKRKSFGESEEPDTTPLHFTRWELQKKDFFMQSPAKLTACDY
HRELDMVVVGFSNGVFGLYQMPDFVCLHLLSISREKITTAIFNSLGNWLVFGCAKLGQLL
VWEWRSESYILKQQGHYFDVNCIAYSPDSQLLATGADDNKVKVWTVSSGFCFITFSEHTN
AVTAVHFMANNHSLLSASLDGTIRAWDLFRYRNFKTFTTALPRQFVSLTADQSGEVICAG
TLDSFEIFVWSMKTGRLLDILSGHQGPVHGLMFSPINAILASSSWDKTVRLWDVFESKGA
VETFQHSHDVLTLAYRPDGRQIACSTLDGLIHFWDPFDGLLMYTIEGRRDIAGGRLMTDR
RSAANTSIGKYFTTLCYSADGTYILAGGNSKYICMYDVGEQVLLRRFQITRNLSLDGVLD
FLNSKKMTDAGVLFLVGSWMMCVHTLLKFCHPVLLKRSRKNISCITSMEYLWVS
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgaactaccgcttccacaacctcctgggcgcgccgtaccgcggcggcgacgccgtcttc
gccggtgactcctccgtcctcctctccgccgtcggcaaccgcgtcgcgtccaccgacctc
tccgcctcctcctccctcacgctccccttcgagtcctcctccaacgtcacccgcctcgcc
gtctccccctcgggcgacttcctcctctccgtcgacgacgccggccgcgcgctctacgcc
aacctcggccgccgcgccgtcctccaccggatcgccttcaagtccgccccctccgccgtc
cgcttcagccccgacggcaacctcatcgccgtcgccgtcggtaagctcgtccagatctgg
cgctcgcccgcgttccgcaaggagttcttccctttccacctgctccgcaccatccctggc
ttcgccgccggtgtcaccgccttcgactggtctcccgactcctcgttcctcctcgcctcc
tgcaaggacctcaccgcccgcctcttgcctgtcaagaaaggccttggaggcaaaccattc
ctcttcgttggccaccgcgccgccgtggttggcgccttcttcgccacagataagaagaca
gggagagtcactggggcttacacaattaccaaggacggagctatctttacatggaatttg
gtggaaggaagtgatgattcgcctccaccttcaccagggacgccagagcaggaggcggta
caggatggtgaggctgaattggacggtgacgagcccgaattggatggcgggagcaggaaa
aggaagagtttcggagaatcggaagaaccagacactaccccgctgcatttcacaaggtgg
gagctgcagaaaaaggacttcttcatgcagtcaccggctaagttaacagcctgtgattac
catagggagcttgacatggtggtggttggtttctctaatggtgtatttgggctgtaccag
atgccagactttgtgtgcctccacttactgtcaatatcaagggagaagatcactactgct
attttcaacagtttggggaattggttagtttttggatgtgccaaacttgggcaattactg
gtgtgggagtggcgatcagagagctacattttgaagcagcaggggcactactttgatgtg
aactgcattgcatactcaccagactcccaattactggccactggagctgatgataacaaa
gtcaaggtctggacagtctcctctgggttctgtttcataacattttcggagcatacaaac
gctgttactgcagttcattttatggccaataatcattctcttctcagtgcctcccttgat
gggactattcgagcatgggatctgttccgctatcgaaatttcaagacatttactactgca
ttgcccagacaatttgtttctttaacggcagatcagagtggagaagtaatatgtgctgga
acacttgattcatttgagatatttgtttggtcaatgaagactggtcgtttgttggatata
ctcagtggtcaccaaggaccagttcatggcctaatgttttcgccaatcaatgctattttg
gcttcatcatcatgggacaaaacagttcgcctttgggacgtatttgagagcaagggtgca
gtggaaacttttcaacattcacatgatgttcttactttggcttatcgccctgatggaaga
cagatagcatgcagcacactagatggcttaatccatttctgggatccatttgacggcctg
ttgatgtatacaattgaaggccgcagggatattgccgggggtcgtctcatgactgacaga
agatctgctgctaatacaagtataggaaagtacttcacaacgttgtgctattctgctgac
gggacttatattttagctggaggaaacagcaaatatatatgcatgtatgatgttggagaa
caggtgctcttgcgtagattccagatcacccgcaatctctcgttggacggagtacttgat
tttctgaactcaaagaagatgacggatgctggtgtacttttccttgttggatcttggatg
atgtgtgtacacaccttactgaaattttgtcacccagttttgttgaaacgatccagaaag
aatatatcatgcatcacaagtatggagtacttgtgggtttcctaa

DBGET integrated database retrieval system