KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os05t0552300-02
Entry
Os05t0552300-02   CDS       T02163                                 

Gene name
Os05g0552300
Definition
(RAP-DB) Similar to Guanine nucleotide-binding protein beta subunit-like protein (GPB-LR) (RWD).
  KO
K14753  guanine nucleotide-binding protein subunit beta-2-like 1 protein
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dosa03019]
    Os05t0552300-02 (Os05g0552300)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dosa04147]
    Os05t0552300-02 (Os05g0552300)
Messenger RNA biogenesis [BR:dosa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     Os05t0552300-02 (Os05g0552300)
Exosome [BR:dosa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Os05t0552300-02 (Os05g0552300)
  Exosomal proteins of colorectal cancer cells
   Os05t0552300-02 (Os05g0552300)
  Exosomal proteins of bladder cancer cells
   Os05t0552300-02 (Os05g0552300)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1
Other DBs
RAP-DB: Os05t0552300-02
Position
chr05:complement(join(27460894..27461787,27459686..27459802))
AA seq 336 aa
MAGQESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEA
APPEYGVSYRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGRTTRRFVGHTKD
VLSVAFSVDNRQIVSAARDNTIKLWNTLGECKYTIGGDHGAGEGHTGWVSCVRFSPNPMA
PTIVSGSWDRSVKVWNLTNCKLRTKLEGHNGYVNAVAVSPDGSLCASGGKDGTTLLWDLT
EGKMLYKLDAGAIIHSLCFSPNRYWLCAATEDSVKIWDLESKLVMQDLKPEVQAFKSQML
YCTSLSWSADGSTLFAGYTDGTIRVWKVSGFGGYAI
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggcgggccaggagtcgctcaccctggcgggcgtcctgcgcggccacaacgacatggtg
acggcgatcgcggcgccgattgacaactcgcccttcatcgtctcctcctcccgcgacaag
tcgctgctggtgtgggacatcaccaacccgtccaccgccgtggccacggatcccgaggcg
gccccgccggagtacggcgtctcgtaccgccgcctcaccggccactcccacttcgtccag
gacgtcgtcctcagctccgacggccagttcgcgctctcgggatcctgggacggcgagctc
cgcctctgggacctagccaccggccgcaccacccgccgcttcgtcggccacaccaaggac
gtcctctccgtcgccttctccgtcgacaaccgccagatcgtctccgcggcgcgcgacaac
accatcaagctctggaacaccctcggcgagtgcaagtacaccatcggcggcgaccatggc
gccggcgagggccacaccgggtgggtctcctgcgtcagattctcccccaaccccatggcc
cccaccatcgtctccggctcgtgggatcgcagcgtcaaggtctggaacctcacgaactgc
aagctgcgcaccaagctcgagggccacaacggctacgtcaacgccgtcgccgtgagccca
gacggctccttgtgtgcctccggtgggaaggacggaaccaccctgctctgggatctcacc
gaggggaagatgctgtacaagctcgacgccggcgccatcatccactccctctgcttctcg
cccaaccgctactggctctgcgccgcgacagaggactccgtcaagatctgggacctcgag
tccaagctcgtcatgcaggacctcaagccagaagtccaggccttcaagagccagatgctg
tactgcacaagtttgagctggagcgctgatggcagcaccctcttcgctggctacactgat
ggaactatcagggtttggaaggtctcagggtttggcggctatgcaatctag

DBGET integrated database retrieval system